Details for Lyrate rockcress Locus 16045335

Position : sca3 ( 5`- 6677652 .. 6679251 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479045 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16045335

Protein [Map View]
MQLFHSCCGKGFDGKKKEKEEPSWRVFSLKELHAATNSFNYDNKLGEGRFGSVYWGQLWDGSQIAVKRLKAWSNREEIDF
AVEVEILARIRHKNLLSVRGYCAEGQERLLVYEYMPNLSLVSHLHGQHSAECLLDWTKRMKIAISSAQAIAYLHDHATPH
IVHGDVRASNVLLDSEFEARVTDFGYGKLMPDDTGDGATRAKSNNGYISPEYVTSGKESETSDVYSFGILLLVLVSGKRP
LERLNPTTTRGITEWVLPLVYERKFGEIVDKRLSEEHVEEKLKKVVLVGLMCAQTDPDKRPTMSEVVEMLVNESKEKMSE
LEANPLFKNPYSNNENNREHVTEVSSDVISEEKDQQQHE*

DNA
ATGCAACTTTTTCATAGCTGTTGTGGTAAAGGATTTGATGGGAAGAAGAAAGAAAAGGAAGAGCCATCTTGGAGGGTATT
TTCATTGAAGGAACTTCATGCGGCCACTAACAGTTTCAATTATGATAACAAACTCGGTGAAGGCCGATTCGGTAGTGTCT
ACTGGGGTCAGCTATGGGATGGATCACAGATTGCAGTCAAGAGATTGAAGGCATGGAGTAACAGAGAGGAGATTGATTTT
GCTGTGGAAGTCGAGATTCTTGCTCGTATTCGTCACAAGAATTTGTTGAGTGTTCGTGGCTACTGTGCAGAAGGCCAAGA
ACGTCTTCTTGTGTACGAGTACATGCCTAATTTGAGCTTGGTTTCGCATCTTCATGGCCAGCATTCAGCTGAATGCCTTT
TAGATTGGACCAAGCGAATGAAGATCGCCATAAGTTCTGCTCAGGCTATTGCCTACCTACACGACCACGCAACCCCACAT
ATAGTCCATGGAGATGTGAGAGCTAGCAATGTGTTACTAGATTCTGAATTTGAAGCTCGGGTTACAGATTTTGGATATGG
TAAGCTGATGCCAGATGATACTGGAGATGGAGCTACCAGAGCCAAAAGTAATAATGGATATATCTCACCAGAATATGTTA
CATCAGGAAAAGAATCAGAAACTAGCGATGTGTACAGTTTCGGTATCCTTTTGCTGGTACTGGTTAGTGGCAAGAGACCA
CTCGAAAGGCTAAATCCAACAACAACGCGAGGTATAACCGAGTGGGTTTTACCACTTGTTTACGAAAGAAAATTTGGTGA
AATCGTTGATAAGAGGCTGAGCGAGGAGCATGTGGAAGAGAAGCTGAAGAAAGTAGTCTTGGTGGGGCTTATGTGTGCTC
AGACAGATCCAGACAAGAGACCAACAATGTCTGAGGTCGTGGAGATGCTGGTGAATGAATCAAAGGAGAAAATGTCTGAA
CTTGAAGCCAATCCGCTCTTCAAGAATCCATATAGCAACAACGAAAACAATAGAGAGCATGTTACAGAGGTAAGCTCAGA
TGTGATCTCAGAAGAGAAAGATCAACAACAACATGAATAG