Details for Lyrate rockcress Locus 16045314

Position : sca3 ( 5`- 4716158 .. 4718770 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045314

Protein [Map View]
MVVKMMKWRPWPPLVTKKYEVKLAVKRLEGWDLVREGVPEKERLTVEIRWKGPKATLGSLRRSVKRNFTKEAVGESDIVS
WEDEEFQSLCSLTSYKDSLFYPWEIAFSVFTNGMKQGQKNKAPLVGTAFLNLAEYARVTDKKEFDINIPLTLSACVTSEP
HPLLFVSLSLLELRTTPETSDSAAQTAVVPVPVPSPSPQQPTETHSIEKEDVSAIKAGLRKVKIFTEFVSTRKAKKACRE
EEGRFSSFESSESLDDFETDFDEGKEDLMSVRKSFSYGPLSYANGAGTSLNCGAKVSDEDEDWVYYSHRKSDVGAGCSDA
EDSAAGLVYETSLLPRRSILPWRKRKLSFRSPKSKGEPLLKKDNGEEGGDDIDYDRRQLSSDEAHPLFGSKIDEDSSANP
RSSFSEFGEDSFAIGSWEEKEVISRDGHMKLQTNVFLASIDQRSERAAGESACTALVAVVADWFQKNGNLMPIKSQFDSL
IREGSLEWRNLCENETYMQKFPDKHFDLDTVLQAKIRPLTVIPGKSFVGFFHPDGMINEGRFEFLQGAMSFDSIWAEIIS
LEESSANSDSYDDDSSPHVYIVSWNDHFFVLKVEKEAYYIIDTLGERLYEGCDQAYVLKFDHKTVIHKILHTEESGSESE
PESEIVCRGKESCKEYIKNFLAAIPIRELQEDIKKGLASTAPVHHRLQIEFHYTTNAEITSLKA*

DNA
ATGGTGGTGAAAATGATGAAGTGGCGGCCATGGCCGCCGTTAGTTACGAAGAAATATGAGGTGAAGCTAGCCGTGAAGAG
ACTTGAGGGTTGGGATCTGGTGCGGGAAGGTGTACCGGAGAAAGAGAGATTAACGGTTGAGATTCGTTGGAAAGGTCCTA
AGGCGACATTGGGATCTTTGAGAAGGTCGGTGAAGAGGAATTTCACCAAGGAAGCTGTTGGAGAAAGCGACATCGTTTCA
TGGGAAGACGAAGAGTTTCAGAGCTTATGCTCACTCACTTCTTACAAAGACAGTTTGTTTTATCCTTGGGAGATTGCTTT
CTCTGTCTTCACCAATGGAATGAAGCAAGGGCAGAAGAATAAAGCTCCTCTTGTTGGAACTGCATTTTTGAATCTTGCTG
AGTACGCTCGTGTGACCGATAAAAAAGAATTCGATATAAACATACCTCTTACGCTCTCTGCTTGTGTGACCTCTGAGCCA
CATCCATTGCTCTTTGTATCATTAAGCCTGCTTGAGCTTAGAACCACTCCAGAAACATCAGACTCGGCAGCACAAACCGC
GGTTGTGCCTGTGCCTGTCCCGTCTCCTTCGCCACAACAGCCTACTGAAACTCACTCAATTGAAAAGGAGGATGTCTCTG
CAATCAAAGCTGGTCTCAGAAAAGTCAAGATTTTTACAGAGTTTGTTTCTACAAGGAAAGCCAAGAAGGCTTGCCGGGAA
GAAGAAGGCAGATTCTCAAGCTTTGAATCATCAGAATCACTTGATGATTTCGAGACAGATTTTGATGAAGGCAAAGAAGA
TTTGATGAGTGTGAGAAAATCTTTCTCCTACGGACCTTTGTCTTATGCAAATGGTGCGGGAACTTCGTTAAACTGTGGCG
CGAAGGTTAGCGATGAAGATGAAGATTGGGTTTATTATAGCCACAGGAAATCCGACGTTGGAGCAGGTTGCTCGGACGCT
GAAGATTCCGCTGCGGGTTTGGTATATGAGACATCACTGCTTCCACGGCGTAGCATATTGCCGTGGAGAAAGCGGAAGTT
GAGCTTTAGGTCGCCGAAATCCAAAGGAGAGCCTTTGTTAAAGAAGGATAATGGAGAAGAAGGTGGAGATGACATTGATT
ATGATCGGAGGCAACTTAGCTCAGATGAAGCTCATCCTCTTTTTGGGAGCAAGATTGATGAAGATTCATCTGCTAATCCG
CGATCTTCTTTCTCGGAGTTTGGAGAAGACAGTTTTGCGATTGGAAGTTGGGAGGAGAAAGAAGTGATAAGCCGAGATGG
ACACATGAAGCTTCAGACAAATGTCTTTCTTGCTTCGATCGACCAGAGAAGCGAGCGAGCAGCTGGTGAGAGTGCCTGCA
CCGCTCTTGTAGCGGTTGTTGCAGATTGGTTTCAGAAGAATGGTAACCTAATGCCGATCAAGTCTCAGTTTGATAGTTTG
ATCAGAGAAGGATCTTTAGAGTGGAGAAACCTCTGCGAAAACGAAACGTATATGCAGAAATTCCCTGACAAACATTTCGA
TCTTGATACCGTGCTACAAGCAAAGATTCGTCCTCTAACCGTTATCCCAGGAAAGTCCTTTGTTGGGTTTTTCCACCCTG
ACGGGATGATCAACGAGGGAAGATTCGAGTTTCTGCAAGGCGCAATGTCTTTCGATAGTATTTGGGCTGAGATTATTAGT
CTCGAGGAAAGCTCCGCGAATAGCGATAGTTATGATGATGACTCGTCACCGCATGTTTACATAGTGAGTTGGAATGATCA
CTTCTTTGTCCTCAAAGTTGAAAAGGAAGCTTACTATATCATTGACACACTTGGAGAAAGGCTTTACGAGGGTTGTGATC
AAGCTTACGTTTTGAAATTCGACCATAAAACTGTCATCCACAAGATTCTTCATACAGAGGAATCGGGATCCGAATCAGAA
CCTGAATCAGAGATTGTGTGCAGAGGGAAGGAGTCATGTAAAGAGTATATTAAGAATTTCTTGGCGGCGATACCAATCAG
GGAGTTGCAAGAGGATATCAAGAAAGGATTAGCCTCGACCGCACCTGTTCATCACCGTTTACAGATCGAGTTTCACTACA
CCACAAACGCAGAGATTACCAGTCTGAAAGCCTAG