Details for Lyrate rockcress Locus 16045054

Position : sca3 ( 5`- 3033873 .. 3035227 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16045054

Protein [Map View]
MANRPHVPKFGDWNNQDQPFTVVFDNARTNKRQDLYESIEKPETKPQEQAPPPPQPASRNQRPEPPKPVKEDTPRAPPPA
EKNRVRAPPADQLYGGGGSGGAGRSGSGGGGGLYGGYGGGSVGNQRQPPAPRPAQPRQNLRGGNNGRGGTTIPPFPGSLG
AGENMSYTHIFDKVKEERNEGVRPYGGTAGNTPSRPINSQHDPSPKQTSSSMFCCFSWCRKGSKY*

DNA
ATGGCAAACCGTCCACACGTTCCAAAGTTTGGGGACTGGAACAACCAAGACCAACCATTCACGGTTGTCTTTGACAACGC
AAGGACGAACAAACGACAAGACTTGTACGAATCTATTGAGAAACCTGAGACCAAACCTCAAGAACAAGCTCCTCCGCCTC
CTCAGCCTGCTAGTAGAAATCAAAGACCGGAACCCCCAAAACCGGTCAAGGAGGACACGCCGAGAGCACCTCCACCAGCG
GAAAAAAACAGAGTCAGAGCTCCACCGGCGGATCAACTCTACGGAGGCGGGGGCAGCGGAGGCGCAGGCAGGAGTGGAAG
TGGAGGCGGAGGTGGACTATATGGAGGTTATGGAGGCGGATCAGTCGGGAACCAGCGGCAGCCACCAGCTCCTCGTCCTG
CGCAGCCTAGACAAAATCTCAGAGGCGGCAACAACGGAAGGGGAGGGACAACGATACCGCCATTCCCAGGATCACTAGGT
GCAGGGGAGAACATGAGTTACACACACATTTTCGACAAAGTCAAAGAAGAGAGAAACGAAGGTGTCAGACCCTACGGCGG
AACAGCCGGCAACACTCCTTCTCGCCCCATCAACAGTCAACATGATCCATCTCCCAAACAAACCTCCTCCTCCATGTTCT
GCTGCTTCTCATGGTGCCGCAAGGGATCTAAATATTGA