Details for Lyrate rockcress Locus 16045044

Position : sca3 ( 5`- 9702096 .. 9703481 -3` )
Annotation : [B2G] zinc finger (b-box type) family protein
External links : CoGe
PGDD synteny : 16045044

Protein [Map View]
MEPKCDHCATSQAVIYCKSDLAKLCQNCDFHVHSANPLSHRHSRSLICQKCFSQPAVIRCLGEKVSYCQRCHWHASNCSD
LGHRVQRLNPFSGCPSPTDFVKMWSSILEPSVSSLVSPFVGSLPLNDPNNTMFGMAKINELDGLIGSPYSMVPHSFNVTQ
NFSDQLSFFSVESKGYPDLVLKLEEGEEDLCEGLNFDNAPLNFDVGDDIIGCSLEEPIEPDHTVPNCLLIDKNNTSVTAS
NFTIDKAFEASSPGQQMNINTGLPLPLSPVLFGQIHPSLNISNVTGESNAADYQDCGMPPGFITSEAPWESNLEVSCPQA
STQAKLRYMEKKLSAPRADTRKRVKGRFVKAGDNYDYDPSSPTTNN*

DNA
ATGGAGCCAAAGTGTGACCACTGTGCAACTTCACAAGCAGTGATTTACTGCAAATCCGATTTGGCTAAACTATGCCAAAA
CTGCGACTTCCACGTACACTCTGCGAATCCTCTATCTCATAGACACTCACGCTCTTTGATCTGCCAGAAATGCTTCTCAC
AGCCAGCCGTAATCCGCTGTCTCGGTGAGAAGGTTTCATATTGCCAAAGATGTCATTGGCACGCAAGCAACTGCTCGGAT
TTAGGACACAGAGTTCAGAGGTTGAACCCTTTCTCTGGTTGTCCTTCTCCAACAGATTTTGTCAAAATGTGGTCTTCAAT
TCTTGAACCTTCTGTCTCTAGTTTGGTTAGTCCGTTTGTTGGTTCTTTGCCCTTGAATGATCCCAATAATACCATGTTTG
GAATGGCGAAAATCAACGAATTAGACGGTTTGATCGGTTCCCCTTATTCCATGGTGCCACACAGCTTCAATGTCACTCAG
AATTTCAGTGATCAATTGTCTTTCTTTTCCGTGGAATCTAAGGGATATCCTGATTTGGTTCTTAAACTTGAAGAAGGCGA
AGAAGATTTATGTGAAGGGCTTAACTTTGACAATGCGCCGTTAAACTTTGACGTTGGAGATGATATTATCGGATGTTCTT
TAGAAGAACCCATAGAACCGGACCATACAGTACCAAATTGCCTACTGATCGACAAGAATAACACATCCGTTACCGCCTCA
AACTTTACTATAGACAAGGCTTTTGAGGCATCGTCACCAGGACAACAAATGAACATCAACACTGGACTTCCGCTTCCTCT
ATCACCTGTCTTGTTCGGACAAATCCATCCATCGCTTAACATCTCCAACGTCACAGGTGAAAGCAATGCAGCTGATTACC
AGGATTGTGGGATGCCTCCAGGGTTTATAACGAGTGAAGCACCATGGGAATCGAATCTTGAAGTTAGTTGTCCACAAGCA
AGTACTCAAGCTAAATTGAGATACATGGAGAAGAAATTAAGCGCTCCAAGAGCTGACACGAGGAAAAGAGTGAAAGGAAG
ATTTGTGAAAGCTGGTGACAATTATGATTATGACCCATCATCACCGACGACAAACAATTGA