Details for Lyrate rockcress Locus 16044993

Position : sca3 ( 5`- 2403459 .. 2402533 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044993

Protein [Map View]
MAIHKLPLLLFLYILLFLNRPVLSDTDEEDILLTGINSYRTTQNLTTLSKNENAECLADEIADQFKNKPCTNDTGSATVP
GTEPQFANYPQILAKCHLNVSDTRDGSIMPACVPRLESSLVLTNFTKSQYSMSLNDSKFTGIGIGKEDDWIVVVLTTNTP
EGSYSTATPTKQESSGFTFSVGLVSYLIIFMFSFGFFLF*

DNA
ATGGCGATTCACAAGCTTCCACTTCTTCTCTTTCTCTACATCCTCCTCTTCCTCAATCGCCCCGTTCTTAGCGACACCGA
TGAAGAGGACATTCTTCTCACAGGCATCAACAGCTACAGAACAACACAGAATCTAACAACCTTGAGCAAGAACGAAAACG
CAGAATGTCTAGCTGACGAAATCGCAGACCAATTCAAAAACAAACCTTGCACTAACGACACTGGCTCAGCCACAGTACCT
GGAACAGAGCCACAGTTCGCAAACTACCCTCAGATTCTAGCCAAATGCCACTTAAACGTCTCTGACACTAGAGACGGCTC
GATTATGCCTGCATGTGTTCCTCGTTTAGAATCAAGCCTCGTCCTCACAAACTTCACCAAGTCGCAGTACTCAATGAGTT
TGAACGATTCAAAGTTTACAGGGATTGGTATTGGTAAAGAAGATGATTGGATCGTAGTGGTTCTCACTACCAACACACCA
GAAGGAAGCTATTCTACAGCTACACCTACAAAACAGGAGTCTAGTGGTTTCACCTTTAGTGTTGGTCTCGTTAGTTATTT
GATCATTTTCATGTTTTCCTTTGGTTTCTTCCTCTTTTGA