Details for Lyrate rockcress Locus 16044980

Position : sca3 ( 5`- 7423845 .. 7423189 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044980

Protein [Map View]
MFKVMRESNMDMDTAVYNIIIHGMCKAGKLEEAWNLFTNLLLSGLQPDVKTYNMMIRFSALGRAEKLYAEMLRRGIVPDT
ITYNSMIHGLCKQNKLAEARKVFDSMDNKSCSTFNTLINGYCKARRVDDGIDLFCEMYRRGIVANVITYTTLIHGFRQVG
DFKTALDIFQEMVSNGVRSSSITFRDILPELCSKKELRKAVAMLVDLQKSVVVCPQRM*

DNA
ATGTTTAAGGTCATGCGGGAGAGTAATATGGATATGGATACTGCTGTTTATAACATCATCATCCATGGAATGTGCAAGGC
TGGTAAGTTGGAGGAAGCATGGAATCTATTCACTAATCTGCTCCTCAGTGGTTTGCAACCTGATGTTAAAACTTACAATA
TGATGATTAGATTCAGCGCGTTAGGGAGGGCTGAAAAATTATATGCAGAGATGCTCCGTAGAGGTATAGTACCCGATACC
ATCACCTATAACTCAATGATCCATGGACTCTGCAAGCAGAACAAACTAGCCGAGGCAAGAAAGGTGTTTGATTCCATGGA
TAACAAGAGCTGCTCAACTTTTAATACACTCATTAATGGTTACTGTAAAGCAAGAAGGGTTGATGATGGGATTGATCTTT
TCTGCGAGATGTATCGAAGAGGAATAGTTGCTAATGTAATTACTTACACTACTTTGATTCATGGGTTTCGTCAAGTTGGT
GATTTTAAAACCGCTTTAGACATTTTCCAGGAGATGGTTTCTAATGGTGTGCGTTCTAGTTCGATAACTTTCCGCGATAT
TCTTCCCGAGTTATGCAGTAAGAAGGAGCTAAGAAAGGCAGTGGCAATGCTGGTGGATTTGCAGAAGAGTGTTGTGGTAT
GTCCTCAAAGAATGTAG