Details for Lyrate rockcress Locus 16044957

Position : sca3 ( 5`- 1748025 .. 1747433 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477763 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16044957

Protein [Map View]
MNLQCCEDFPSRIKKLLRKVKGVYAITIDPVKGLILVSGTAEPSVLIKAVAKIGQSPQLYAYEKDPATAKTRFRTLLKRY
ATNKGQDEPSSPAPVTATNPVETCPAGGGTFRGFGYPGPPTMMQMPAFTLPPRMGPPGWLAPSAKPRLMVKYEEPKVTTR
KPPAPYPFDFYENLGFPPSDSLFNYFSDENAQPCTIM

DNA
ATGAATCTCCAGTGTTGTGAAGACTTTCCTTCTCGGATAAAGAAGCTTTTGCGCAAAGTAAAAGGAGTTTACGCCATAAC
CATAGACCCTGTGAAGGGTCTGATTTTGGTCTCTGGCACAGCAGAACCTTCAGTGCTTATCAAAGCCGTCGCAAAAATCG
GGCAAAGTCCCCAACTTTACGCCTACGAGAAGGATCCAGCTACGGCTAAGACCCGATTCCGCACCTTGCTTAAACGGTAC
GCCACCAACAAGGGCCAAGATGAACCATCCTCCCCTGCACCTGTCACGGCAACCAACCCCGTGGAAACTTGTCCAGCGGG
AGGTGGAACATTTAGAGGTTTCGGGTATCCTGGACCACCGACGATGATGCAGATGCCGGCCTTTACGTTGCCCCCAAGGA
TGGGACCGCCTGGATGGTTAGCACCGTCGGCAAAACCGAGGTTGATGGTGAAGTACGAGGAGCCAAAGGTGACGACCAGG
AAACCGCCAGCGCCTTATCCCTTTGATTTCTACGAAAACTTGGGTTTTCCACCATCCGACTCTCTTTTCAACTATTTCAG
CGATGAGAACGCTCAACCTTGCACTATCATGTG