Details for Lyrate rockcress Locus 16044954

Position : sca3 ( 5`- 512291 .. 512906 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044954

Protein [Map View]
MKKWSYAKLMTSVLLFLFVIILLLAFHGGSTGDNHQYVHVAIGAKDSMGRKLKHLEPKTESLKMINPKKTNEFEYSDQVS
NDLLEREVFFDTMATDYRGLKRRKPPINN*

DNA
ATGAAGAAGTGGAGTTATGCGAAGTTAATGACCTCAGTTTTATTGTTTCTCTTCGTAATCATTCTTCTTTTGGCCTTTCA
TGGAGGATCAACAGGTGACAATCATCAGTATGTTCATGTGGCCATCGGAGCTAAGGATTCGATGGGACGAAAGTTAAAAC
ATTTGGAACCAAAAACTGAATCGTTGAAAATGATCAATCCAAAAAAGACGAACGAGTTTGAGTATTCAGATCAAGTATCC
AATGATTTATTAGAAAGAGAAGTATTTTTCGATACTATGGCTACGGACTACCGAGGCCTAAAAAGAAGAAAGCCCCCCAT
CAACAATTGA