Details for Lyrate rockcress Locus 16044908

Position : sca3 ( 5`- 9136412 .. 9138195 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044908

Protein [Map View]
MLVVSESYLLSHPLYLKALKLCSYQNVKKQLLLIHGNSVTNGFGSNLQLNDMLIDLYLKQGDVKHARKLFDRIPKRDVVS
WTAMISRFSRCGYHRDALLLFKQMHRQDVRANQFTYGSVLKSCKDLGCLKEGMQIQGCLEKGKCAGNLIVRSALLSLYAR
CGKMEDARLQFDSMKERDLVSWNSMIDGYTTNACVDTSFSLFQLMFAEGKKPDCFTFGSLLRASIVVKCLEPVGQLHGLA
IKLGFGRSSALIRSLVDAYVKCGSIANAWKLHEDTTKRDLISCTALITGFAQQNICTSDAFDIFNEMILMKTKMDEVVVS
SMLKICTTIASVTVGRQIHGFALKSSQIRFDIALGNSLIDMYAKSGDIEDAVLAFEEMKEKDVRSWTSLIAGYGRHGNFE
KAIDLYNRMEHEGIKPNDVTFLSLLSACSHTGQTELGWKIFNKMINKHGIKAREEHFSCIIDMLARSGYLEEAYELIRSK
DGIISLSSSTWGAFLDACRRHGNVQLSKVAASQLLSVEPKKPVNYINLASVHAANGAWDSALKTRQLMKESGSCNKTPGY
SLVY*

DNA
ATGCTGGTTGTTTCGGAAAGCTACTTATTAAGCCATCCTTTGTACCTCAAGGCTCTCAAGTTATGCAGCTACCAAAACGT
CAAGAAACAACTTTTGTTGATTCATGGGAATTCGGTGACAAATGGGTTCGGCTCCAATCTCCAGTTGAACGACATGTTGA
TAGATTTGTACTTAAAACAGGGAGATGTGAAACATGCACGTAAACTGTTCGATAGAATTCCTAAGAGAGATGTGGTTTCT
TGGACAGCTATGATCTCGAGGTTTTCTCGATGTGGATATCACAGGGACGCGTTGTTGTTGTTCAAACAGATGCACCGGCA
AGATGTTAGGGCTAATCAGTTCACTTACGGGAGTGTTTTGAAGTCGTGTAAAGATTTGGGATGTCTTAAAGAAGGGATGC
AGATACAAGGTTGTTTGGAGAAAGGGAAATGTGCAGGGAACTTAATTGTGAGGAGTGCATTGCTTTCTCTTTATGCCAGG
TGTGGAAAGATGGAGGATGCTCGTCTTCAGTTTGATTCAATGAAAGAAAGGGATTTGGTTTCTTGGAATTCAATGATCGA
TGGATACACCACCAATGCTTGTGTAGATACTTCGTTTAGTCTGTTTCAGTTAATGTTCGCGGAAGGGAAGAAGCCAGACT
GCTTCACCTTTGGAAGCCTCTTGAGAGCTTCTATTGTAGTTAAGTGTCTTGAACCAGTCGGTCAATTACATGGATTAGCG
ATCAAGCTGGGTTTTGGAAGATCAAGTGCTCTGATTAGGTCTCTGGTTGATGCATATGTGAAGTGTGGTAGCATTGCCAA
TGCTTGGAAACTGCACGAGGACACAACAAAAAGAGACTTAATATCTTGCACTGCTCTAATTACAGGTTTTGCACAGCAGA
ACATCTGCACAAGTGATGCCTTTGATATCTTCAACGAGATGATACTGATGAAAACAAAGATGGACGAGGTTGTAGTATCT
TCAATGCTTAAAATATGCACCACCATCGCATCGGTAACCGTTGGAAGACAGATCCATGGTTTTGCCTTAAAATCTTCCCA
AATCAGATTTGATATTGCTTTGGGTAACTCGCTGATAGATATGTATGCAAAGTCCGGGGACATCGAGGATGCAGTCCTCG
CTTTCGAAGAGATGAAAGAGAAAGATGTGAGATCATGGACCTCTTTGATCGCAGGATATGGAAGACATGGGAATTTTGAG
AAAGCAATTGATCTTTATAACAGAATGGAGCATGAAGGGATCAAACCGAATGACGTTACATTTCTTTCTCTCCTTTCTGC
TTGTAGCCATACAGGACAAACCGAACTAGGCTGGAAGATTTTCAACAAAATGATCAACAAGCACGGTATCAAAGCTCGAG
AAGAGCACTTCTCTTGCATCATAGATATGCTTGCGCGCAGTGGCTACTTGGAAGAAGCTTATGAACTGATAAGAAGTAAA
GATGGTATTATAAGTCTAAGCTCATCAACATGGGGAGCTTTTCTTGATGCATGCAGGCGCCATGGGAACGTGCAGCTCAG
TAAAGTAGCAGCCTCGCAGCTTCTGAGTGTGGAACCGAAGAAACCAGTCAATTATATCAATTTGGCCAGTGTACATGCAG
CTAATGGAGCATGGGATAGTGCTTTGAAGACCAGACAGCTTATGAAAGAGAGTGGTTCCTGCAATAAAACTCCAGGATAC
AGCCTTGTGTATTAA