Details for Lyrate rockcress Locus 16044832

Position : sca3 ( 5`- 5552382 .. 5553343 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044832

Protein [Map View]
MEGGAEDLSVEIVGLLETAYERREPMTKIRKQLERMSETLAEAVPHSKYAEAIVKGMLLAVQRRANLNASKKPSIRFLIH
IYGPILIPYATSKTTQVCGEDICLEPQSPFFPVFGDIIQTLSRHCVNVEAIVDWEERRKEARERGILSPQEMNLLRNMEN
TQSGPTGGILEGFEIGKGSQDARDMGL*

DNA
ATGGAAGGTGGCGCTGAGGATCTGAGTGTTGAGATTGTTGGTCTACTGGAAACGGCTTATGAGAGGCGTGAGCCGATGAC
GAAAATCCGTAAACAGCTTGAAAGAATGTCAGAGACTTTGGCCGAAGCTGTGCCTCACTCAAAATATGCGGAGGCCATTG
TGAAGGGAATGCTTCTTGCTGTTCAAAGACGTGCAAACCTAAACGCATCCAAGAAACCATCGATCAGGTTTTTGATACAT
ATATATGGTCCTATCCTTATTCCATATGCCACCAGCAAAACTACCCAAGTCTGTGGAGAAGATATATGTCTTGAACCTCA
GTCACCATTTTTCCCCGTTTTTGGTGATATAATCCAGACCTTGTCACGCCATTGTGTAAACGTGGAAGCCATTGTTGATT
GGGAAGAGCGTAGGAAAGAAGCAAGAGAGAGAGGAATTCTGTCTCCACAAGAGATGAATCTTCTGAGGAATATGGAAAAT
ACCCAAAGTGGTCCTACCGGTGGCATCCTTGAAGGATTTGAGATTGGAAAAGGAAGCCAGGACGCTCGAGACATGGGCCT
CTAA