Details for Lyrate rockcress Locus 16044828

Position : sca3 ( 5`- 6304200 .. 6306260 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044828

Protein [Map View]
MAETERPHRSSSINSSSNNGSSTDLFICFTSRFSSSSSMRLSSKSIHSPARAACLTTSLSRRLRTSGSLKNASAGVLNSP
MFGANGGRKRSGSGYENSSNNNNNIEPSSPKVTCIGQVRVKTRKHVKKKMRARSRRKGGDSSFRRSVDQNDGGGGGGGCR
FDASENRWVHLPVTICESLRSFGSELNCFFPCRSSCTENIHGDGRRVESNNDGCGGGGGGSSCGAVFTRWFVAVEETSGG
KRREIELVVGGEDEVEEDRRRSRRRHVFEGLDLSEIEMKTEKKERGGEEVGRMSICSPPKNALLLMRCRSDPVKVAALAN
RVRERQLSLNDGVYGGGTEEEDDERRRRFELEIEDRKRIDLCEKWISGETNVETEEVSVTVAEAEVEVPLPSNPATEEEE
RVKAVEDSIVEEEQEDEASKILDSFEEEIEATIMKNIEDEIRNAIEEDEKLAEMEDLAAVAVAETEEDEESKEVTVAACI
TQNEERSEQGNREPDPSPEVVMRRSLQEETTEKEKATPYKVLPDCLLLMMCEPKLSMEVSKETWVCSTDFVRCLPGRPPA
KKIPPEATGDNHHHHHQPKKRIVTAVDSNASSRRRSIDKPPLHLQPPRSSCSYPAAPPIIMAAAAVGEQKVAGANKAYEP
PVLPRCKSEPRKSASKLAPEACFWKNRKLEPHPPASVGVGGAGVGF*

DNA
ATGGCGGAAACTGAGAGACCCCACCGTTCTTCAAGTATTAACAGTAGTAGCAACAATGGTTCTTCTACCGATCTATTCAT
TTGTTTCACATCTCGTTTCTCTTCTTCTTCCTCTATGCGTCTCTCTTCCAAATCCATCCATAGTCCAGCTCGTGCCGCTT
GTCTCACTACTTCTCTAAGCCGTCGTCTCCGTACTAGCGGTAGCTTGAAGAACGCTTCAGCTGGAGTTTTGAACTCTCCG
ATGTTTGGTGCTAACGGAGGACGGAAGAGATCTGGATCTGGTTACGAGAATAGTAGCAACAACAACAATAACATAGAGCC
GTCGTCTCCGAAGGTGACGTGTATTGGTCAAGTTAGAGTGAAGACTAGGAAGCATGTGAAGAAGAAGATGAGAGCTAGAT
CTAGGAGGAAAGGAGGTGACTCGAGTTTTAGGAGATCCGTTGATCAAAACGACGGTGGTGGTGGTGGAGGTGGATGTCGT
TTTGATGCGAGTGAGAATCGTTGGGTGCATCTTCCGGTGACTATCTGTGAGTCGTTGAGATCGTTTGGGTCTGAGCTCAA
CTGCTTCTTCCCGTGTAGATCTTCGTGTACGGAGAATATTCATGGAGATGGGAGGCGAGTTGAGAGTAACAACGACGGTT
GCGGCGGCGGAGGAGGAGGAAGTTCGTGTGGTGCGGTGTTTACGAGGTGGTTTGTGGCGGTGGAGGAGACGTCCGGAGGG
AAGAGAAGAGAGATTGAGCTTGTAGTTGGTGGAGAAGACGAAGTGGAGGAGGATAGGCGGAGGAGTCGTCGGAGACATGT
TTTCGAGGGGCTTGATTTGAGTGAGATTGAGATGAAGACGGAGAAGAAAGAGAGAGGAGGAGAAGAAGTTGGACGGATGA
GTATTTGTTCTCCGCCGAAGAATGCTTTGTTGTTGATGCGGTGTAGATCTGATCCGGTTAAGGTGGCGGCGTTAGCTAAC
CGGGTTCGTGAAAGACAGTTGTCGTTAAACGACGGCGTATACGGTGGAGGAACAGAGGAGGAAGATGATGAGAGACGAAG
AAGGTTTGAGCTGGAAATTGAAGATAGGAAACGGATCGACTTGTGTGAGAAATGGATCTCCGGCGAAACTAATGTGGAGA
CAGAAGAAGTTTCAGTTACAGTTGCAGAAGCAGAAGTAGAAGTTCCTTTGCCTTCAAATCCAGCTACAGAGGAAGAAGAA
AGAGTCAAAGCTGTGGAAGATTCGATTGTTGAAGAAGAACAAGAAGACGAAGCTTCGAAAATTCTGGATTCGTTTGAGGA
AGAAATTGAAGCTACGATCATGAAAAACATTGAAGACGAAATCAGAAACGCTATAGAAGAAGATGAGAAACTGGCTGAGA
TGGAAGACTTAGCGGCGGTGGCGGTGGCTGAGACGGAGGAGGACGAAGAAAGCAAAGAGGTTACTGTTGCTGCCTGTATA
ACTCAAAATGAGGAAAGATCCGAACAAGGAAACCGAGAACCCGACCCGAGTCCGGAAGTGGTGATGAGAAGAAGTCTACA
AGAGGAAACAACGGAGAAAGAGAAGGCGACGCCGTATAAGGTGTTACCGGATTGTTTGCTGCTAATGATGTGTGAACCAA
AGCTCTCAATGGAAGTCTCTAAGGAGACTTGGGTCTGCAGTACAGATTTCGTCAGATGTTTACCAGGAAGACCTCCGGCG
AAGAAGATACCTCCAGAAGCTACCGGAGATAATCATCATCATCATCATCAACCCAAGAAGCGGATCGTCACGGCCGTTGA
TTCCAACGCATCATCTCGCCGGCGGTCAATCGATAAACCACCCTTACACCTTCAGCCGCCACGGTCATCGTGTTCATACC
CAGCAGCTCCACCAATAATAATGGCAGCTGCGGCGGTTGGGGAGCAGAAGGTAGCCGGAGCTAATAAGGCCTATGAGCCA
CCAGTGCTGCCACGTTGCAAATCGGAGCCGAGAAAGTCAGCGTCGAAGCTAGCGCCGGAAGCTTGTTTCTGGAAAAATAG
GAAGCTCGAGCCACATCCTCCGGCTAGCGTCGGAGTCGGCGGCGCCGGGGTAGGGTTCTAG