Details for Lyrate rockcress Locus 16044815

Position : sca3 ( 5`- 4866776 .. 4865363 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478556 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16044815

Protein [Map View]
MKTPARRSKRIDQESEINVTTRVVLRTRKTNCSKTRAARVRPDYPLTRSTSESEMKLMPLEFFQIDALDLAPRLLGKFLR
RDNVVLRITEVEAYRPNDSACHGRFGVTPRTAPVFGPGGHAYVYLCYGLHMMLNIVADKEGVGAAVLIRSCSPVSEMETI
QERRGLKTDKPVLLNGPGKVGQALGLSTEWSHHPLYSPGGLELLDGGEYVEKVMVGPRVGIDYALPEHVNALWRFAIADT
PWISTPKNTLKPL*

DNA
ATGAAAACGCCGGCTCGTCGATCGAAGCGGATTGATCAGGAATCGGAGATCAATGTTACAACCCGAGTAGTCCTACGGAC
ACGAAAGACCAACTGTTCCAAGACTCGAGCGGCTCGGGTCAGACCCGATTACCCACTGACCCGCTCCACCTCCGAGTCCG
AGATGAAGTTAATGCCTCTGGAGTTCTTTCAAATCGACGCGCTTGATCTTGCGCCACGTTTGCTTGGCAAGTTCCTAAGG
AGAGACAATGTTGTGCTGCGAATTACAGAGGTAGAAGCTTATAGACCAAATGATTCAGCTTGCCATGGACGATTTGGTGT
TACCCCACGGACCGCACCAGTGTTTGGACCAGGAGGACATGCTTATGTTTATCTATGTTATGGTCTCCATATGATGCTCA
ATATTGTTGCTGATAAGGAAGGAGTTGGAGCTGCTGTTTTGATACGGTCTTGTTCTCCTGTTTCCGAAATGGAGACTATA
CAGGAGCGTCGTGGCCTGAAAACCGACAAACCTGTTCTTCTAAATGGACCAGGAAAGGTTGGTCAAGCGCTAGGACTCTC
AACAGAGTGGTCTCATCATCCACTTTATTCTCCTGGAGGACTGGAGCTTCTTGATGGAGGAGAATATGTGGAGAAAGTAA
TGGTTGGCCCTCGCGTTGGAATAGATTACGCATTGCCTGAACATGTCAATGCCTTGTGGAGATTTGCTATTGCAGACACT
CCATGGATAAGTACTCCTAAGAACACTCTTAAGCCTCTCTAA