Details for Lyrate rockcress Locus 16044803

Position : sca3 ( 5`- 9540196 .. 9539068 -3` )
Annotation : [B2G] histidine-containing phosphotransmitter 3
External links : CoGe
PGDD synteny : 16044803

Protein [Map View]
MDLVQMQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQ
LKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVELGF*

DNA
ATGGATTTGGTTCAGATGCAGAAGAGTTTGCAAGATTACACCAAATCACTCTTCTTGGAAGGGATTTTGGACAGCCAGTT
CTTGCAGCTGCAGCAACTACAAGATGAAAGCAATCCTGATTTTGTTTCACAAGTTGTCACACTCTTCTTCCAAGACTCTG
ATAGGATTCTCAATGATCTCTCACTTTCCCTAGATCAACAAGTTGTAGACTTCAAAAAAGTTGATCCCCATGTTCATCAA
CTCAAAGGTAGCAGCTCCAGTATAGGAGCACAGAGAGTTAAGAATGCTTGTGTTGTCTTCCGCAGCTTCTGCGAGCAACA
AAATGTCGAAGCATGTCATAGATGTTTGCAACAAGTGAAGCAAGAGTACTATCTTGTGAAGAACAGATTAGAGACTCTGT
TCAAGCTGGAGCAGCAGATTGTAGCTTCTGGCGGAATGATCCCGGCAGTGGAACTCGGATTTTGA