Details for Lyrate rockcress Locus 16044643

Position : sca5 ( 5`- 17940084 .. 17938014 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044643

Protein [Map View]
MVKPSDFKAVHKLIQLHYSRVNLVSKTGRSKLSAFSSPTLPSNGVSQLQAKSGFHSFSSRPTAKNFGLSQILPSNGVSQL
QPKTSFHSFLSRPTSKNLGLSQILPSSPKLVPSLQNCGVALVKPRVNVNFASAFRLFSSSGFRKIDGNFARKVVDKPIQA
VSSTFARYRMALGLHIDAFWKKNNLLVFGAGAVFVCIFLWRIMFGIASTFVGLSEGMAKYGFLALSSAIVAFAGLYLRAR
FTINPDKVYRITMRKLNTAADVLEVMGAPLAGSDLRAYVMSGGGITFKKFKPTIRNKRCFLLFPVQGSERKGLVSVEVKK
KKGQYDMKLLAVDIPMASGPDQRLFLIGDEVEYRVGGGLISELRDPVVKAMAATKEFDNLDRIEEEEDAERELQEAERKE
REEIELQEAERKEREEIELQEAERKQREEIEKIGKESS*

DNA
ATGGTGAAGCCCTCTGATTTCAAAGCAGTGCACAAACTTATTCAATTGCATTACAGTCGAGTCAACCTGGTCTCAAAGAC
GGGCCGGTCAAAACTCTCCGCTTTTTCTTCTCCGACTCTTCCTTCAAATGGGGTTTCTCAGCTTCAGGCTAAGTCCGGTT
TCCACAGCTTTTCGTCGAGACCCACTGCGAAAAACTTTGGCTTGTCCCAGATTCTTCCCTCTAATGGGGTTTCTCAGCTT
CAACCTAAGACCAGTTTCCACAGCTTTTTGTCAAGACCCACTTCGAAAAATTTGGGATTATCCCAGATTCTACCCAGTAG
TCCTAAGCTCGTACCTAGTTTGCAGAATTGTGGTGTAGCGTTGGTTAAGCCCCGTGTTAATGTGAACTTTGCATCGGCTT
TTAGATTGTTTTCGAGCTCTGGGTTTCGAAAAATCGATGGGAATTTCGCTAGAAAGGTTGTTGACAAGCCAATCCAAGCT
GTTAGTTCGACTTTTGCTAGATACCGAATGGCTTTAGGGTTGCACATTGATGCATTTTGGAAGAAGAATAACCTTTTGGT
GTTTGGAGCTGGAGCTGTTTTTGTATGTATTTTCTTGTGGAGAATCATGTTTGGAATTGCTAGCACATTCGTTGGTCTCT
CTGAGGGAATGGCCAAGTACGGCTTCCTTGCTCTCTCATCTGCCATTGTTGCATTTGCTGGTTTATATCTTCGCGCAAGG
TTCACGATAAATCCCGATAAAGTTTATAGGATCACTATGAGGAAGCTTAATACAGCAGCTGATGTTCTTGAAGTTATGGG
TGCTCCTCTGGCAGGATCAGATTTGCGTGCTTATGTGATGTCAGGTGGTGGCATAACATTCAAAAAATTCAAGCCAACAA
TTAGGAACAAGCGTTGCTTCCTCCTATTCCCGGTTCAAGGTTCTGAGAGAAAGGGCCTTGTTAGTGTCGAAGTCAAGAAG
AAGAAAGGCCAGTATGATATGAAACTACTGGCAGTGGATATTCCAATGGCGTCTGGTCCTGATCAACGCTTATTCCTTAT
TGGTGATGAAGTAGAGTACAGAGTCGGTGGTGGTTTGATCTCTGAGTTAAGAGATCCTGTGGTAAAAGCAATGGCAGCAA
CCAAAGAATTTGATAATCTTGACAGAATTGAAGAGGAAGAAGACGCCGAAAGAGAACTTCAAGAAGCCGAAAGGAAGGAA
CGTGAAGAAATTGAACTTCAAGAAGCCGAAAGGAAGGAACGTGAAGAAATTGAACTTCAAGAAGCGGAAAGAAAACAGCG
TGAAGAAATTGAGAAGATCGGAAAAGAGAGTTCTTAG