Details for Lyrate rockcress Locus 16044589

Position : sca3 ( 5`- 6631187 .. 6631674 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044589

Protein [Map View]
MLSCSNGTVVIATAMVCSSTALFLAMARQFHGNHQTSKVLDQTPRPILRSCLSSEKTRKQRKRIKKVRFADNVKDTEGNG
KEYRRRELNRRSVPEPVTKPGKTGSMCRISTMPANRMALYNGILRDRDHRVQCSY*

DNA
ATGTTGAGCTGTTCTAATGGTACCGTCGTGATCGCAACCGCCATGGTTTGCTCAAGCACCGCTCTGTTTCTCGCCATGGC
TCGTCAATTCCATGGAAACCATCAAACCTCTAAGGTTCTTGATCAGACTCCACGACCCATTCTCCGTTCTTGTTTATCTT
CAGAGAAAACGAGGAAACAGAGGAAGAGGATAAAGAAAGTGCGGTTCGCGGATAATGTGAAAGACACGGAAGGGAACGGG
AAAGAATACCGGAGGAGGGAATTGAACCGGAGAAGCGTACCGGAGCCAGTGACTAAACCGGGGAAGACCGGTTCTATGTG
TAGAATCTCTACCATGCCAGCGAACCGGATGGCTCTGTACAATGGGATTCTCAGAGACCGAGATCACAGAGTTCAATGTT
CTTATTGA