Details for Lyrate rockcress Locus 16044576

Position : sca3 ( 5`- 637092 .. 639200 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044576

Protein [Map View]
MVLRGEELEFNLREWARKGHLTREDQSSRRFSASCIRSFREDHKSTSCTTNFTISSTASSPGYSLKGDEIDPSNYSFTSA
LKALQEKTVYKKNWDWLKPEGVELNSKWNEAEKYICNPLSGEVPLECLSSKTLNSRSFRNLSTKHAPLMILPSNPNPNIP
RIIHEDPKTPDPVLIQEKKVVGSKRDVVSAPENVSAVKTTPIMERSTKRQVEADDSHVEYALKLKAQQEDVKLEEKEQNM
MTKEIREEKKRGSGCFSMSWKKKMQKQPRTSKCIFLICLPHLFKAS*

DNA
ATGGTTTTGCGTGGCGAAGAGCTTGAGTTTAACCTAAGAGAATGGGCACGAAAAGGCCATTTAACTCGCGAAGATCAAAG
TTCTAGAAGGTTCTCTGCCTCTTGTATCCGAAGCTTCCGAGAGGACCACAAGTCGACGTCCTGTACAACAAACTTCACCA
TCTCTAGTACTGCCTCTTCTCCCGGTTACTCGCTCAAAGGTGATGAGATTGACCCATCAAATTATTCCTTCACTAGTGCA
CTCAAGGCATTGCAAGAAAAAACAGTGTACAAGAAGAATTGGGATTGGTTGAAACCAGAAGGAGTTGAGCTAAACTCGAA
ATGGAACGAAGCAGAGAAGTATATTTGCAATCCTTTGTCTGGTGAAGTTCCTTTGGAGTGTTTGTCTTCTAAAACCCTAA
ATTCAAGATCTTTTAGAAACTTATCCACCAAGCATGCTCCACTCATGATTTTACCTTCTAATCCTAATCCCAACATTCCA
AGAATCATCCACGAGGATCCTAAAACTCCCGATCCTGTTCTTATTCAAGAAAAAAAAGTTGTGGGGTCAAAACGAGATGT
CGTTAGTGCACCGGAAAATGTTAGTGCAGTGAAGACGACGCCGATCATGGAGAGATCGACGAAAAGACAGGTGGAAGCTG
ATGATTCGCATGTTGAGTATGCACTAAAGTTGAAAGCTCAACAAGAGGATGTGAAGTTAGAAGAAAAGGAGCAAAATATG
ATGACAAAAGAAATTCGAGAAGAAAAGAAAAGAGGAAGTGGGTGTTTCTCAATGTCATGGAAAAAGAAAATGCAAAAACA
ACCAAGAACATCCAAATGCATATTTCTCATTTGTCTTCCTCATCTTTTCAAAGCTTCTTGA