Details for Lyrate rockcress Locus 16044553

Position : sca3 ( 5`- 7490912 .. 7492124 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044553

Protein [Map View]
MRSEIVRETKLIFDLPQDVIEEIFSKVPVTSLRRLRSTCKRLYALLKDQGFIKKHFAKSARHLASEAIISQAFHCDGLLL
CTTKENRLVVWNPFSGQTRWLQLQNRGRIDEAYVLGYDNRDVCHSYKILSFPDLYEQELETIKNAWKDLDVTPEGDLELK
INDSSSNSWRRNLGVTPLGDLELKLYDFSSNSWKHLDVITPEGCLKSYGVSLKGNAYWVYVSNRRGVNDYSILSFDFSTE
RFQHLCVPFHQEADCFDTMALSVFREEHLSLLYQSSETLKVEIWMTKEIDTTFVSWRKFLIVDLEPHLPMFSCRMSFFIY
EEKKVAVCCDRDNKVYIIGEDEYKVSSGFYFVDFEGITCCLTVFGYVPRLV*

DNA
ATGAGGTCAGAAATCGTAAGAGAAACAAAGTTAATCTTCGATCTTCCACAAGATGTGATAGAGGAGATTTTTTCTAAGGT
TCCGGTGACATCTCTAAGAAGATTACGATCTACTTGCAAAAGATTGTACGCTTTACTCAAAGATCAAGGATTCATCAAAA
AACATTTTGCTAAATCAGCAAGGCATTTAGCTTCAGAAGCCATTATATCTCAAGCATTTCACTGTGATGGTTTATTGCTA
TGCACCACCAAGGAAAACCGATTAGTGGTTTGGAACCCGTTTTCGGGGCAAACCAGATGGTTGCAACTGCAAAATCGTGG
TAGGATAGATGAGGCCTATGTTCTCGGATACGACAACAGGGACGTGTGCCATAGCTACAAAATCTTGAGTTTTCCGGATT
TATACGAACAAGAATTGGAAACTATCAAGAATGCATGGAAGGATCTTGATGTCACTCCCGAAGGCGACTTAGAATTGAAA
ATCAATGATTCTAGCTCTAATTCATGGAGGAGAAATCTTGGTGTCACTCCCCTAGGCGACTTAGAATTGAAACTATATGA
TTTTAGCTCTAATTCATGGAAGCATCTTGATGTCATCACTCCCGAAGGTTGCTTAAAATCTTATGGCGTGTCATTGAAGG
GAAATGCTTATTGGGTGTACGTGTCTAATCGAAGAGGAGTTAACGACTACTCTATACTTAGTTTTGATTTTTCAACAGAG
AGATTTCAACATTTGTGTGTTCCCTTTCATCAGGAAGCAGATTGTTTTGATACCATGGCTCTCTCGGTTTTTAGAGAAGA
ACATCTTTCGTTGTTATATCAGAGTAGCGAGACACTAAAGGTGGAAATATGGATGACCAAAGAGATTGATACAACATTTG
TGTCATGGAGAAAGTTCTTAATAGTGGATTTAGAACCTCATCTCCCTATGTTTTCGTGTCGAATGAGTTTCTTCATCTAC
GAGGAGAAGAAAGTTGCCGTGTGTTGTGACAGAGATAACAAGGTATACATTATTGGAGAAGATGAATACAAAGTATCTTC
CGGTTTTTATTTTGTAGATTTTGAAGGCATAACATGTTGCCTAACTGTCTTTGGTTATGTACCAAGATTGGTTTAA