Details for Lyrate rockcress Locus 16044497

Position : sca3 ( 5`- 4001896 .. 4001447 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044497

Protein [Map View]
MQTVSVDETKNTVVIRAVHKNEEGRKSVDKFELKTRNPETIKSVERKLMEKGVQRMDRHPSDGIPLRRPPPKSGHGGKYT
WEGPDRMEDYEMQPDPPAIDEGDPNYDEEQAKKIDDDVAVELVKGEVEVAKEAPAGVARVDVDPRLVSR*

DNA
ATGCAGACGGTATCAGTTGACGAAACCAAAAACACGGTGGTGATACGGGCGGTGCACAAGAACGAAGAAGGACGGAAATC
TGTTGATAAGTTCGAATTGAAGACACGTAATCCGGAGACGATCAAGAGCGTTGAGAGGAAGCTTATGGAGAAAGGTGTTC
AACGGATGGATCGTCATCCTTCCGATGGGATTCCTCTCAGGCGACCGCCGCCTAAGTCCGGTCACGGTGGGAAGTACACG
TGGGAAGGACCTGATCGGATGGAGGATTACGAGATGCAGCCGGATCCACCGGCGATAGATGAAGGAGATCCTAATTATGA
TGAGGAACAGGCGAAGAAGATTGATGATGACGTGGCGGTTGAGCTTGTGAAAGGAGAGGTTGAGGTGGCGAAGGAAGCGC
CGGCTGGTGTGGCGAGGGTTGACGTTGATCCACGCTTGGTCAGTCGTTGA