Details for Lyrate rockcress Locus 16044476

Position : sca3 ( 5`- 9150962 .. 9149103 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044476

Protein [Map View]
MRNSVKREAKLTRDRSSRREAGESSERPKIVKKEKQSKTVIASLRPQEPPIQEEDEQGIADRRAIRSQYLALTHQIKDAK
DDLTKIDSDKFKRIINEVENLHQKVKKPREQIADAEALLDLANSVVSSVKSQSAHGGVSPAEFVNALINGFGKTCLRIDA
DDNTQVSLKWKDLGFTVCSTVMVSCGCTTMMGPMDSELKQRKRSVGNRKRTKPGVGVKPEEVDDKEGEKKSDTDNNMAVM
FNILRKNKRVKIENLVLNRKSFAQTAENVFALSFLVKDGRVEITVDNNGSHFVEPRNAPAANLVLSGEVAYNHFVLRFDY
KDWEPMSTMVAVGEELMPHRETKVAQDSRELSRKQGSVIQDETVVEDSSNIEGDNKDSHNGGLPRKCKIRKTDHL*

DNA
ATGAGAAACTCGGTGAAACGGGAAGCGAAATTAACCAGAGATCGCAGCAGCAGAAGAGAAGCCGGTGAGTCCTCTGAGAG
ACCGAAAATCGTGAAGAAGGAGAAGCAGAGTAAAACCGTTATTGCTTCATTACGGCCTCAAGAACCACCGATTCAGGAAG
AGGACGAACAAGGAATTGCTGATCGGAGAGCTATAAGATCTCAGTACCTTGCTCTTACCCATCAGATTAAAGATGCTAAA
GATGATTTGACAAAAATTGATTCTGACAAGTTTAAGCGTATCATTAATGAGGTTGAGAATTTGCATCAGAAAGTTAAGAA
GCCTAGAGAGCAAATTGCTGATGCGGAGGCGCTTTTAGATTTAGCGAATAGTGTGGTTTCATCGGTGAAATCGCAATCTG
CTCATGGAGGTGTTTCTCCAGCTGAGTTTGTTAATGCCTTGATCAATGGGTTTGGGAAAACTTGTTTAAGAATTGATGCT
GATGACAATACACAAGTGTCATTGAAGTGGAAGGACCTTGGGTTTACGGTCTGCTCTACAGTTATGGTATCATGTGGTTG
TACAACAATGATGGGTCCTATGGATAGTGAATTGAAACAAAGGAAAAGGTCAGTGGGCAACAGAAAACGTACAAAGCCTG
GTGTTGGTGTTAAGCCAGAGGAGGTTGATGATAAAGAAGGTGAAAAGAAAAGTGATACAGACAATAACATGGCAGTAATG
TTTAACATCTTGAGGAAAAACAAACGTGTCAAGATTGAAAATTTGGTGCTCAATAGGAAATCATTTGCTCAGACAGCAGA
GAATGTGTTCGCACTATCATTCTTGGTGAAAGATGGACGAGTTGAGATAACTGTCGATAACAATGGTTCTCATTTCGTTG
AGCCAAGGAATGCTCCTGCAGCAAACCTGGTGCTGTCAGGGGAGGTCGCTTACAACCATTTCGTACTTAGATTTGATTAC
AAAGATTGGGAGCCAATGAGCACAATGGTGGCAGTGGGAGAGGAGCTGATGCCACACAGGGAAACCAAAGTCGCACAAGA
TTCAAGAGAACTGTCGAGGAAACAAGGTTCGGTGATTCAAGATGAAACGGTTGTCGAAGATTCTTCTAACATCGAAGGCG
ATAATAAAGATAGTCATAATGGTGGATTACCCCGGAAATGCAAGATCAGGAAGACTGATCACTTGTGA