Details for Lyrate rockcress Locus 16044459

Position : sca3 ( 5`- 2659356 .. 2660252 -3` )
Annotation : [B2G] gns1 sur4 membrane family protein
External links : CoGe
PGDD synteny : 16044459

Protein [Map View]
MASVYSTLTYWLVHHPYIANFTWTEGETLGSTVFFVFVVVSVYLSATFILRYTVDSLPSLGPRILKPITAVHSLILSLLS
LTMAVGCTLSLISSQDPKARLFDAVCFPVDVKPKGPLFFWAQVFYLSKILEFVDTLLIILNKSIHRLSFLHVYHHATVVI
LCYLWLRTRQSLFPICLVTNSTVHVIMYGYYFLCAVGSRPKWKKLVTNVQIVQFVFGLGLGAVWMLPEHYFGSGCSGIWA
SYFNGVFSASLLALFYNFHSKNYVKTTTSSMYKIESFIFINGERWAKKAIRLFSMKND*

DNA
ATGGCATCGGTTTACTCCACCCTAACCTACTGGCTCGTGCACCACCCCTACATCGCCAACTTCACATGGACCGAAGGTGA
AACCCTAGGCTCTACCGTCTTCTTTGTCTTCGTCGTCGTTTCTGTTTACCTCTCCGCCACATTCATCCTCCGATACACCG
TGGATTCACTCCCCTCTCTCGGTCCCCGCATTCTCAAACCGATCACAGCCGTCCACAGCCTCATTCTCTCCCTCCTCTCC
TTAACCATGGCCGTTGGTTGCACTCTCTCCCTAATCTCGTCTCAAGATCCGAAGGCGCGCCTCTTCGACGCCGTTTGTTT
CCCAGTCGACGTGAAACCTAAGGGACCGCTTTTCTTTTGGGCTCAAGTCTTTTACCTCTCCAAGATCCTGGAGTTCGTAG
ACACACTTCTCATCATACTCAACAAATCAATCCACCGGCTCTCGTTCCTCCACGTCTACCACCACGCAACGGTTGTGATT
TTGTGCTACCTCTGGTTACGAACACGCCAATCTTTGTTTCCGATTTGTCTCGTGACGAACTCGACGGTCCATGTCATTAT
GTACGGTTACTACTTCCTCTGCGCCGTTGGATCGAGGCCCAAGTGGAAGAAGTTGGTGACGAATGTTCAAATTGTTCAGT
TTGTTTTCGGCTTGGGGTTAGGAGCCGTTTGGATGCTCCCGGAGCATTATTTCGGGTCAGGTTGCTCCGGGATTTGGGCA
AGTTATTTCAATGGTGTGTTTAGTGCTTCTCTCTTGGCTCTCTTCTACAACTTCCATTCCAAAAACTACGTGAAGACTAC
AACCTCGAGTATGTATAAGATCGAATCCTTTATATTTATAAACGGAGAGAGGTGGGCAAAGAAAGCGATTAGATTATTTT
CCATGAAAAATGATTAA