Details for Lyrate rockcress Locus 16044453

Position : sca3 ( 5`- 788728 .. 788133 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044453

Protein [Map View]
MANCIRRNALFFLTLLFLLSVSNLVQAARGGGKLQPQQCNSKCSYRCSATSHKKPCMFFCLKCCKKCLCVPSGTYGNKQS
CPCYNNWKTKEGGPKCP*

DNA
ATGGCGAATTGTATCAGAAGAAATGCTCTTTTCTTTTTGACTCTTCTCTTTTTACTGTCAGTCTCCAACCTCGTTCAGGC
TGCTCGTGGTGGTGGCAAACTCCAACCCCAACAATGCAACTCAAAGTGTAGCTACCGTTGTTCAGCAACATCACACAAGA
AGCCATGCATGTTCTTTTGCCTCAAGTGTTGCAAAAAATGTCTCTGTGTTCCTTCTGGTACTTACGGCAACAAACAAAGT
TGTCCATGTTACAACAACTGGAAGACTAAAGAAGGCGGCCCAAAATGTCCTTAA