Details for Lyrate rockcress Locus 16044443

Position : sca3 ( 5`- 11844028 .. 11838395 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479958 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16044443

Protein [Map View]
MQRQRSILSFFQKPSPATTQGLVSGDATSGGGGGVGGGLRLNVKDDASVRFAVSKSVDEVRGTDTPPEKVPRRVLPSGFK
TAESAGGGASSLFSNIMHKFVKVDDRECSGQRSREDVVPLNDSSVCMKADDVIPEFRSNNGQTQERDHAFSFSGRVEDNI
GVDDDVPGPETPGIRPSVSRLKRVLEDGMTVKEDKVPVLDSNKRLKMLQDPVCGEKKEVNEGTKFEWLEPSRIRDANRRR
PDDPLYDRKTLYIPPDVFKKMSASQKQYWSVKSEYMDIVLFFKVGKFYELYEVDAELGHKELDWKMTMSGVGKCRQVGIS
ESGIDEAVQKLLARGYKVGRIEQLETSDQAKARGANTIIPRKLVQVLTPSTASEGNIGPDAVHLLAIKEIKMELEKCSTV
YGFAFVDCAALRFWVGSISDDASCAALGALLMQVSPKEVVYDSKGLSREAQKALRKYTLTGSMAVQLAPVSQVMGDTDAA
GVRNIIESNGYFKGSSESWNCAVDGLNECDVALSALGELINHLSRLKLEDVLKHGDIFPYQVYRGCLRIDGQTMVNLEIF
NNSCDGGPSGKHRRKYSTTWYGSLVRTLYKYLDNCVSPTGKRLLRNWICHPLKDVVSINKRLDVVEEFTANSEIMQTTGQ
YFHKLPDLERLLGRIKSSVQSSASVLPALLGKKVLKQRVKAFGQTVKGFRSGIDLLLALQKESNMMSLLCKLCKLPILVG
NNGLELFLSQFEAAIDSDFPNYQNQDMTEENAETLTILIELFIERVTQWSEVIHTISCLDVLRSFAIAASLSAGSMARPV
IFPESENTDQNQEIKGPILKIQGLWHPFAVAADGQLPVPNDILLGEDRNRSNSIHPRSLLLTGPNMGGKSTLLRATCLAV
IFAQLGCYVPCESCEISLVDTIFTRLGASDRIMTGESTFLVECTETASVLQNATQDSLVILDELGRGTSTFDGYAIAYSV
FRHLVEKVQCRMLFATHYHPLTKEFASHPRVTSKHMACAFKSKSDQAPRGCDQDLVFLYRLTEGACPESYGLQVALMAGI
PNQVVETASDAAQAMKRSIGENFKSSELRSEFSSLHEDWLKSLVGISRAAHNNAAIGEDDYDTMVCLWHEIRSSYCVPK*

DNA
ATGCAGCGCCAGAGATCGATTCTGTCTTTCTTCCAAAAGCCCTCGCCGGCGACTACTCAGGGTTTGGTTTCCGGCGATGC
TACCAGTGGAGGCGGCGGCGGCGTCGGAGGAGGATTGCGACTCAATGTGAAAGACGACGCTTCTGTACGCTTTGCTGTTT
CGAAATCTGTGGATGAGGTTAGAGGAACGGATACTCCACCGGAGAAGGTTCCGCGTCGTGTTCTGCCGTCTGGATTTAAG
ACGGCTGAATCCGCCGGAGGTGGTGCTTCGTCATTGTTCTCTAATATTATGCATAAGTTTGTGAAGGTCGATGATCGAGA
ATGTTCTGGACAGAGGAGCCGAGAAGATGTTGTTCCCCTGAATGATTCATCTGTATGTATGAAAGCTGATGATGTTATTC
CTGAATTTCGTTCCAATAATGGTCAAACTCAAGAAAGAGACCATGCTTTTAGCTTCAGTGGGAGAGTAGAAGATAATATA
GGAGTAGATGATGATGTTCCTGGTCCAGAAACACCAGGGATACGTCCAAGTGTTTCTCGCTTGAAGCGAGTTTTGGAGGA
TGGAATGACTGTTAAGGAGGATAAGGTTCCTGTATTGGATTCTAATAAAAGGCTGAAAATGCTTCAGGATCCGGTTTGTG
GAGAGAAGAAAGAAGTAAACGAAGGAACCAAATTTGAGTGGCTTGAGCCTTCTCGAATCAGGGATGCTAATAGAAGACGG
CCTGATGATCCACTTTACGACAGAAAGACCTTATACATACCACCTGATGTTTTCAAGAAAATGTCTGCGTCGCAAAAGCA
ATATTGGAGTGTTAAGAGTGAATATATGGATATTGTGCTTTTCTTTAAAGTGGGAAAGTTTTATGAGCTGTATGAGGTAG
ATGCGGAATTAGGTCACAAGGAGCTTGACTGGAAGATGACCATGAGCGGTGTAGGAAAATGCAGACAGGTCGGTATCTCT
GAAAGTGGGATAGATGAGGCAGTGCAAAAGCTTTTAGCTCGTGGATATAAAGTTGGACGAATCGAGCAGCTAGAAACATC
TGACCAAGCAAAAGCCAGAGGTGCTAATACTATAATTCCAAGGAAGCTAGTTCAGGTATTAACTCCATCAACAGCAAGCG
AGGGTAACATTGGGCCTGATGCTGTCCATCTTCTTGCTATAAAAGAGATCAAAATGGAGCTAGAAAAGTGTTCAACTGTG
TATGGATTTGCTTTTGTTGACTGTGCTGCCTTGAGGTTTTGGGTCGGGTCCATCAGCGATGATGCATCATGTGCTGCTCT
TGGAGCTTTATTGATGCAGGTTTCTCCAAAGGAAGTGGTATATGACAGTAAAGGGCTATCAAGAGAAGCCCAAAAGGCTC
TAAGGAAATATACATTGACAGGGTCTATGGCGGTACAGTTGGCTCCAGTATCACAAGTAATGGGGGATACAGATGCTGCT
GGAGTTAGAAATATAATAGAATCTAATGGATACTTTAAAGGTTCTTCTGAGTCATGGAACTGTGCTGTTGATGGTCTAAA
TGAATGTGATGTTGCCCTTAGTGCTCTTGGAGAGCTAATTAATCATCTGTCTAGGCTAAAGCTAGAAGATGTACTTAAGC
ATGGAGATATTTTTCCATACCAAGTTTACAGGGGTTGTCTCAGAATTGATGGCCAGACGATGGTAAATCTTGAGATATTT
AACAATAGCTGCGATGGCGGTCCTTCAGGCAAACACAGAAGGAAATATTCTACTACTTGGTATGGATCTTTAGTAAGGAC
CTTGTACAAATATCTTGATAACTGTGTTAGTCCTACTGGTAAGCGGCTCTTAAGAAATTGGATCTGCCATCCACTCAAAG
ATGTAGTAAGCATCAATAAACGGCTTGATGTAGTTGAAGAATTCACGGCAAACTCAGAAATTATGCAAACCACCGGCCAG
TATTTTCACAAACTTCCAGACTTAGAAAGACTGCTCGGACGCATTAAGTCAAGCGTTCAATCATCAGCCTCTGTTTTGCC
TGCTCTTCTGGGGAAAAAAGTGCTGAAACAACGAGTTAAAGCATTTGGGCAAACTGTGAAAGGGTTCAGAAGTGGAATTG
ATTTGTTGTTGGCTCTACAGAAGGAATCAAATATGATGAGTTTGCTTTGTAAACTCTGTAAACTTCCTATATTAGTTGGA
AACAATGGGCTAGAGTTATTCCTTTCTCAATTCGAAGCAGCCATAGATAGCGACTTTCCAAATTATCAGAACCAAGATAT
GACAGAGGAGAATGCTGAAACTCTTACAATACTTATTGAACTATTTATCGAAAGAGTCACTCAATGGTCTGAGGTCATTC
ACACCATAAGCTGCCTAGATGTCCTGAGATCTTTTGCAATCGCAGCAAGTCTCTCTGCTGGAAGCATGGCCAGGCCTGTT
ATTTTTCCCGAATCAGAAAATACAGATCAAAATCAGGAAATAAAAGGGCCAATACTTAAAATCCAAGGACTATGGCATCC
ATTTGCAGTTGCAGCTGATGGTCAATTGCCTGTTCCAAATGATATACTCCTTGGTGAGGATAGAAACCGCAGCAACAGCA
TTCATCCTCGGTCCTTGTTACTGACAGGACCAAACATGGGTGGAAAGTCAACTCTTCTTCGTGCAACATGTCTTGCCGTT
ATCTTTGCCCAACTTGGCTGCTATGTGCCATGTGAGTCTTGCGAAATCTCCCTTGTGGATACTATCTTCACAAGGCTTGG
TGCATCTGATAGAATCATGACAGGAGAGAGTACCTTCTTGGTAGAATGCACTGAGACAGCGTCAGTTCTTCAAAATGCAA
CACAAGATTCACTAGTAATCCTTGACGAACTGGGCAGAGGAACTAGTACTTTCGATGGATACGCCATTGCATACTCGGTT
TTTCGTCACCTGGTAGAGAAAGTCCAGTGTCGGATGCTCTTTGCAACACATTACCACCCTCTCACCAAGGAATTCGCGTC
TCACCCACGTGTCACCTCGAAACACATGGCATGCGCATTCAAATCAAAATCTGATCAAGCACCACGTGGCTGTGACCAAG
ACCTAGTGTTCTTGTACCGTTTAACCGAGGGGGCTTGTCCTGAGAGCTACGGACTTCAAGTAGCCCTCATGGCTGGAATA
CCAAACCAAGTGGTTGAAACAGCATCAGACGCTGCTCAAGCCATGAAGAGATCAATTGGCGAAAACTTCAAATCAAGTGA
GCTAAGGTCTGAGTTCTCAAGTCTGCATGAAGACTGGCTCAAATCATTGGTAGGTATCTCTCGAGCCGCCCACAACAATG
CCGCCATTGGCGAAGATGACTACGACACTATGGTTTGCTTATGGCATGAGATCAGATCCTCTTACTGTGTTCCCAAATAA