Details for Lyrate rockcress Locus 16044438

Position : sca1 ( 5`- 29182422 .. 29182162 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044438

Protein [Map View]
MAPWTDILTNAAIFVIIQALAFLIIFTSSDIFSSKIKMKAKKRSFGFKLSRSISHLFALTSDDVSRADEEEVAEEEASFL
LSSNLN*

DNA
ATGGCTCCTTGGACCGACATATTGACAAATGCTGCTATTTTTGTGATAATCCAAGCTCTAGCGTTTCTGATAATCTTCAC
TTCTTCCGACATATTCTCCTCCAAGATCAAGATGAAGGCGAAGAAGAGATCTTTTGGTTTCAAACTCTCTCGTTCCATTT
CGCATTTATTCGCTTTAACCTCCGATGATGTCTCTCGAGCTGACGAAGAAGAAGTAGCAGAAGAAGAAGCTTCCTTTCTC
CTCTCCTCAAATCTCAATTGA