Details for Lyrate rockcress Locus 16044436

Position : sca3 ( 5`- 7236878 .. 7241425 -3` )
Annotation : [B2G] calmodulin-binding protein
External links : CoGe
PGDD synteny : 16044436

Protein [Map View]
MDGDGSGRLIGSEIHGFHTLQDLDVQTMLEEAKSRWLRPNEIHAILANPKYFTINVKPVNLPNTGRIILFDRKMLRNFRK
DGHNWKKKKDGRTVKEAHEHLKVGDEERIHVYYAHGEDNTTFVRRCYWLLDKARENIVLVHYRDTQEAGTTSGDSNSSPI
SVSDQAFPNLVTAEDIDFSIENSRYLASNNDTVVRNHDISLHDINTLDWDELLVPTDLNNQSAPTVDDLSYFTDSLQNAA
NGTAEHVNATVADGSLDALLNNGPQSRESFGRWMNSFISESNGSLEDPSFEPMVTPKQDPLAPQAVFHSHSNIPEQVFNI
TDVSPSWAYSSEKTKILVTGFLHDSYQHHANLYCVCGDFCVPAEYLQAGVYRCIIPPHSPGMVNLYLSADGHKPISQCFR
FEHRSVPVLDKTVPEENQESKWEEFEFQVRLSHLLFTSSNKLNVLSSKIPPSNLRDAKKLASKTNHLLNSWAYLIKSIQG
NKVSFDQAKDHLFELTLKNRLKEWLMEKVLEGRNTLDYDSKGLGVIHLFAILGYTWSVQLFSLSGLSLNFRDKQGWTALH
WAAYYGREKMVAALLSAGARPNLVTDSTKDNLGGCMAADLAQQNGYDGLAAYLAEKCLIAQFRDMIIAGNISGDLEACKA
EMLNQGTLPEDEQSLKDALAAYRTAAEAAARIQGAFREKALKAARSSVIQFANKEEEAKSIIAAMKIQNAFRKYDTRRKI
EAAYRIQCRFQTWKIRREYLNMRRQAIRIQAAFRGLQARRQYKKILWSVGVLEKAVLRWRQKRKGFRGLQVAAEEDSSGE
AQEDFYKTSKRQAEERLERCVVRVQAMFRSKKAQEDYRRMKLTHEEAQLEYDCLEDI*

DNA
ATGGACGGCGACGGTTCAGGCAGACTAATCGGCTCGGAGATTCATGGATTCCATACCCTACAAGATCTTGATGTCCAGAC
AATGTTGGAAGAAGCAAAAAGCAGGTGGCTACGGCCAAACGAGATCCATGCAATCCTCGCTAACCCTAAATACTTCACCA
TCAATGTCAAGCCGGTGAACTTACCCAATACTGGCAGAATAATATTGTTCGACCGTAAGATGTTGAGGAACTTCAGAAAG
GATGGTCATAACTGGAAAAAGAAAAAGGATGGAAGGACGGTTAAGGAGGCTCATGAACACCTGAAAGTTGGTGACGAGGA
AAGGATTCATGTATACTATGCGCACGGTGAAGATAACACTACCTTTGTTCGAAGGTGTTATTGGTTACTAGATAAGGCTC
GAGAGAACATCGTCCTCGTACATTACCGTGATACACAGGAGGCAGGTACAACATCGGGGGACTCAAACTCTAGTCCAATC
TCCGTCTCTGATCAAGCATTCCCAAATCTCGTGACAGCTGAAGATATTGATTTTAGCATTGAGAATTCACGTTATCTAGC
AAGCAACAACGATACCGTTGTTAGAAATCATGATATTAGCCTTCATGATATCAATACGCTTGATTGGGATGAGCTGCTAG
TACCAACCGATCTTAATAACCAATCTGCACCAACCGTAGATGATCTGTCATACTTCACAGATTCGCTCCAAAATGCTGCA
AATGGCACTGCAGAGCATGTGAATGCGACAGTGGCTGATGGATCTCTTGATGCTTTGCTTAACAATGGTCCACAAAGTCG
AGAGAGTTTTGGAAGGTGGATGAATTCATTTATCAGCGAATCTAATGGCTCGCTGGAGGATCCTTCCTTTGAACCCATGG
TTACGCCTAAGCAGGACCCATTAGCTCCTCAAGCTGTATTTCATTCTCACTCTAACATACCTGAGCAAGTGTTTAACATA
ACCGATGTTTCACCTTCTTGGGCCTATTCTTCAGAGAAAACTAAGATTCTTGTAACTGGGTTCTTGCATGACAGTTATCA
ACATCATGCAAACCTTTATTGCGTTTGCGGTGACTTTTGTGTCCCTGCAGAATATCTCCAGGCGGGAGTGTACCGTTGTA
TCATACCTCCGCACTCACCTGGGATGGTAAACCTCTATCTTAGCGCAGATGGACACAAACCAATCAGCCAATGTTTCAGG
TTTGAACACCGTTCAGTCCCAGTTCTTGATAAGACCGTCCCTGAAGAAAATCAAGAATCCAAATGGGAAGAATTTGAGTT
CCAAGTCAGACTTTCTCATCTTCTGTTTACTTCTTCCAACAAACTCAACGTTCTCTCTAGCAAAATCCCACCTTCTAACC
TGCGAGATGCTAAAAAACTCGCTAGCAAAACAAACCATCTCTTAAACAGCTGGGCTTATCTAATCAAGTCCATCCAGGGG
AATAAGGTGTCGTTTGATCAAGCGAAAGATCACCTCTTCGAGCTTACTCTGAAGAACAGGCTTAAGGAATGGCTTATGGA
GAAAGTGCTTGAAGGTCGCAACACATTGGATTATGATTCTAAAGGCCTCGGTGTGATCCACCTCTTTGCCATTCTTGGAT
ACACTTGGTCGGTCCAGCTGTTCTCCTTGTCAGGCTTATCGTTGAATTTCCGTGATAAACAAGGCTGGACTGCTCTTCAT
TGGGCAGCATACTACGGAAGGGAGAAAATGGTGGCTGCTCTTCTCTCTGCTGGGGCGAGACCGAACCTAGTGACAGACTC
GACGAAGGATAATCTTGGTGGATGCATGGCGGCTGATTTGGCACAGCAAAACGGATATGACGGTTTAGCTGCTTATCTTG
CTGAGAAATGTTTGATTGCTCAGTTTAGAGACATGATAATTGCTGGAAACATCAGTGGTGATCTGGAGGCTTGCAAGGCG
GAGATGTTGAACCAAGGCACTCTCCCAGAAGATGAGCAGAGTCTCAAGGACGCTCTTGCAGCATACAGAACAGCTGCAGA
AGCAGCAGCTCGGATTCAGGGTGCGTTTAGGGAAAAAGCGCTGAAGGCAGCACGGTCAAGCGTGATTCAGTTTGCTAACA
AAGAAGAAGAGGCTAAGAGCATAATCGCGGCGATGAAGATTCAGAATGCATTCCGGAAATATGATACGCGTAGGAAGATA
GAAGCCGCTTACCGGATTCAATGCAGGTTCCAAACTTGGAAAATACGAAGAGAGTATCTGAACATGCGGCGTCAAGCAAT
TAGGATTCAGGCTGCTTTCAGGGGATTACAAGCAAGGAGGCAGTACAAGAAGATTTTATGGTCGGTAGGAGTGTTGGAGA
AGGCAGTTTTGAGGTGGAGACAAAAGAGAAAAGGTTTTAGAGGACTCCAGGTTGCAGCAGAGGAGGATTCTTCTGGTGAG
GCACAGGAAGATTTCTACAAGACAAGCAAGAGACAAGCAGAGGAAAGGCTCGAGAGATGTGTAGTGCGAGTCCAAGCCAT
GTTCAGGTCTAAGAAGGCTCAAGAGGATTACAGAAGGATGAAACTGACTCATGAAGAAGCTCAGTTGGAGTACGATTGCC
TTGAAGACATTTGA