Details for Lyrate rockcress Locus 16044413

Position : sca3 ( 5`- 4066265 .. 4066885 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16044413

Protein [Map View]
MKLTKLNPKRFFIRSKDPSTVSKSPAASSFGSATSSSGQDCKTSGGGGSVTPTSILPEVPSPYSYIEILQAFKLIDRDND
GAVSRHDLESLLSRLGPEPLTEEEINVMIKEVDGDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRDGLISADE
LLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMMDLQR*

DNA
ATGAAACTCACCAAACTAAATCCAAAACGTTTCTTCATCAGATCCAAAGATCCTTCCACTGTTTCTAAATCCCCCGCGGC
TTCTTCCTTTGGATCCGCCACCTCATCTTCCGGCCAAGACTGTAAAACCTCCGGCGGTGGCGGTTCCGTTACGCCGACTA
GCATTCTCCCAGAGGTTCCCTCTCCTTATTCCTACATCGAGATTCTCCAAGCGTTTAAGTTGATAGACAGAGACAACGAC
GGAGCTGTCTCGAGACACGATCTTGAGTCGTTACTTAGCCGGCTCGGTCCTGAGCCATTGACGGAGGAGGAGATCAACGT
TATGATTAAAGAGGTGGATGGCGACGGAGACGGTACGATCCGTTTAGAAGAGCTTGCGAGTCGTGTAGTCTCTTTAGATC
CCGCTCGTGATTCGACTGAGCTAAAGGAGACTTTTGAGTTCTTTGACGCGGATCGTGACGGTTTGATCTCAGCTGATGAG
CTTCTTAGAGTTTTCTCGACCATTGGAGATGAACGGTGCACGTTAGATGATTGCAAGCGTATGATAGCAGATGTTGATGA
GGACGGTGATGGATTTGTATGCTTCACTGAGTTCTCACGAATGATGGATCTTCAGCGTTGA