Details for Lyrate rockcress Locus 16044357

Position : sca3 ( 5`- 6429994 .. 6432821 -3` )
Annotation : [B2G] ubiquitin-conjugating enzyme 23
External links : CoGe
PGDD synteny : 16044357

Protein [Map View]
METNVVEIAPPVASCSRAKAETPEVIDVEEYEMQNGGVLNGNNVDNKNKGKAIDFDSVSYDEQDDEFVSGDDYDYPGSSP
ISNSLLDPDTLIYEDDENYSEQYDFEMEEETDNYSMYQDLFDGKDIPTGVEVSMDWFPNSADKESASGSSKSSNKSDVTG
NSSKKATKGSGIQSQFSFPDMATPIAQPWNALPHKAGGVIPNSAYALPQNSKAFQPPFTLGSSTSKTYFSNHFQPQTPDT
VLGEAPAPAAGSSGLLLQVPPNTPGFKGYGARYRVEEAILPPDASRVKRNMEDFLGLYLFFKRFDIVEDFSDHHYASKGN
SSKQHSKEWAKRIQDEWKILEKDLPDMIFVRAYESRMDLLRAVIIGAQGTPYHDGLFFFDIFFPDTYPSVPPTVHYHSGG
LRINPNLYNCGKVCLSLLGTWSGSQREKWIPNTSTMLQVLVSIQGLILNQKPYFNEPGYESSAGSAHGENSSKAYSENTL
LLSLKTMVYTMRRPPKYFENFAYGHFFSCAHDVLKACNAYRNGGIPGFLVKGAQDVEENSENSSSKKFRTDVATFVETVL
LKEFILLGVLGLEPEGEDKAPETNNVAESSHNTRSSAKRDRVSSS*

DNA
ATGGAGACCAACGTAGTGGAGATCGCTCCTCCGGTCGCTTCTTGCTCGAGAGCAAAGGCTGAAACTCCAGAAGTGATTGA
TGTGGAGGAATATGAAATGCAAAACGGTGGTGTTCTTAATGGCAACAATGTTGATAACAAGAATAAAGGGAAGGCTATTG
ATTTTGATTCCGTTTCTTACGATGAGCAAGATGATGAGTTTGTTTCGGGTGATGATTATGATTACCCTGGATCATCTCCA
ATATCAAATAGTTTGTTAGACCCAGATACTTTGATCTATGAAGACGACGAAAACTATTCCGAACAATATGACTTTGAAAT
GGAGGAGGAGACTGATAATTACTCCATGTATCAAGACCTTTTCGATGGTAAGGATATCCCAACTGGTGTGGAGGTGTCAA
TGGATTGGTTTCCAAATTCAGCTGACAAGGAATCAGCGAGTGGAAGCAGCAAATCGTCTAATAAGTCAGATGTTACCGGT
AACAGTTCCAAGAAAGCAACAAAAGGAAGTGGAATCCAATCTCAGTTTTCTTTCCCAGATATGGCAACCCCTATTGCTCA
ACCATGGAATGCTTTACCGCACAAAGCTGGAGGAGTCATACCAAACTCTGCTTATGCCTTGCCACAGAACAGCAAGGCTT
TTCAACCACCTTTTACTCTCGGTTCTTCAACCTCCAAAACGTATTTTTCCAATCATTTTCAGCCTCAGACTCCTGATACA
GTATTGGGGGAGGCTCCAGCTCCTGCTGCAGGTTCTTCTGGTTTATTGCTTCAGGTACCACCAAACACACCCGGTTTTAA
AGGTTATGGTGCTCGGTATAGAGTGGAAGAGGCGATATTACCTCCGGATGCTTCCAGAGTTAAAAGAAATATGGAGGATT
TTCTGGGGCTTTATTTGTTTTTCAAAAGATTTGACATCGTCGAAGATTTTTCAGATCACCACTATGCTTCTAAGGGAAAT
TCTTCAAAGCAGCATTCGAAGGAATGGGCGAAAAGGATTCAAGACGAGTGGAAAATTCTTGAGAAAGATTTACCAGATAT
GATATTTGTCAGAGCTTATGAATCTAGGATGGATCTTTTAAGGGCTGTAATTATCGGAGCGCAAGGAACTCCATACCATG
ATGGTCTGTTCTTTTTTGATATCTTCTTCCCGGATACATACCCTTCTGTGCCACCGACTGTTCATTACCATTCTGGTGGG
CTGAGAATCAACCCGAATCTGTACAATTGTGGGAAAGTCTGTCTGAGTCTTCTCGGCACTTGGAGTGGTAGCCAGAGGGA
GAAATGGATCCCCAACACTTCCACAATGTTGCAGGTTCTTGTCTCGATCCAAGGTCTCATCTTAAATCAAAAACCTTACT
TCAACGAGCCTGGCTACGAGAGTTCAGCGGGTTCTGCACATGGTGAGAATAGCTCTAAGGCTTACAGCGAAAACACACTC
CTACTGTCTTTAAAGACTATGGTTTACACCATGAGGAGACCACCCAAGTATTTTGAAAACTTTGCGTATGGACATTTCTT
CAGCTGTGCTCACGACGTGTTGAAGGCGTGTAATGCCTATAGAAACGGAGGTATACCGGGATTTCTGGTGAAGGGGGCTC
AAGATGTGGAAGAGAATAGCGAGAACAGTAGCTCTAAGAAGTTTAGGACAGATGTGGCTACCTTTGTGGAGACAGTGCTG
TTGAAAGAGTTTATTCTTCTAGGTGTCCTTGGTCTCGAACCGGAAGGAGAAGACAAAGCACCTGAGACTAACAACGTTGC
AGAGAGTAGCCACAATACCAGATCAAGCGCCAAGAGAGACAGAGTTTCTTCTAGTTGA