Details for Lyrate rockcress Locus 16044316

Position : sca3 ( 5`- 3827181 .. 3829328 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044316

Protein [Map View]
MSTESERVESVSEASASRFEVGNDQMSETLAGQAQELKTYGDDKEGCGNLASAGDNGMEKVNGFTDLEKETESVNGGLDL
GTGTENVGGESNESENKVLVDSEEVLMVEERELLIEKEVEPDMVCSHGADLRDVKVSDSEDLGEDRKLDGLEKQGTKVED
LDVVCFMGLEPHESKDRSILDDDNFLVTAKVKISDSDLVWAKVRSHPWWPGQVFDASAATDKAKKYFKKGSFLVTYFGDC
TFAWNDASRVKPFRQHFSQMAKQSSLPDFIDAIDFALEEVSRRIEFGLACSCISEEVYQKIKTQNIINPGIREDSSTIHG
GDKVSSAVFFEPADLVGYVKRLACSPIYDATDALQLVSQRAQLLAFNRWKGYTDLPEFVTLQGSVESAPKISPAEEKSSL
VEVSDLEPKKSKQVYTKRRKTEVQDDCKHDGVFEYEETTVPKKKEKTLAEFIAEKRLSRHNRNTSHENSGKVPHCEKKRK
VVQSKVPKSTKKIKENLQTEDPGSPISHKNDRKNSLSAGDKITPEKARKSFGIGASILKVANQMHCSTPTRLIPCSDSTS
KKAAKSNGNGKSLQEKPKAEALSAREISPSTNETLSSPHAASVTKTPSGKSNSISVDHQLSGELEQVIKEAPSTNLVEDP
MLESRDLKDSAKEQMVHEDKKEAANIADEKTIIKDSNLIGEKISGLDLKQQPNKNCSDSSKEDVSAE*

DNA
ATGTCGACGGAATCAGAACGTGTTGAATCAGTCTCAGAGGCTAGTGCGTCGAGGTTTGAGGTTGGAAATGATCAAATGTC
TGAAACCCTAGCTGGTCAAGCTCAGGAGCTGAAAACATATGGAGATGATAAAGAAGGATGCGGCAACTTAGCTTCAGCTG
GTGATAATGGGATGGAGAAAGTAAATGGATTTACTGATCTGGAGAAGGAAACGGAATCTGTAAATGGAGGGTTAGATCTA
GGCACTGGAACCGAAAATGTAGGTGGAGAGAGTAACGAAAGTGAGAACAAGGTCCTAGTAGATAGCGAAGAGGTATTGAT
GGTAGAGGAAAGGGAGCTTTTGATTGAGAAGGAAGTGGAACCTGACATGGTCTGTTCTCATGGCGCTGATCTCAGGGATG
TGAAGGTTTCTGATAGTGAAGACCTTGGTGAGGATAGAAAACTCGATGGCTTAGAAAAGCAAGGAACAAAAGTTGAGGAT
TTGGATGTTGTATGTTTTATGGGTTTAGAACCGCATGAGAGCAAGGATAGAAGTATTTTGGATGATGATAATTTCCTTGT
AACTGCGAAGGTGAAGATCTCTGACTCAGATTTGGTTTGGGCTAAAGTAAGGAGCCATCCGTGGTGGCCTGGACAGGTGT
TTGATGCCTCGGCTGCAACAGACAAGGCGAAGAAGTATTTCAAGAAAGGAAGTTTCTTAGTAACTTATTTTGGAGATTGC
ACCTTTGCTTGGAACGATGCGTCACGGGTAAAGCCTTTTCGACAGCACTTCTCCCAAATGGCAAAGCAGAGTAGTCTACC
TGATTTTATTGATGCTATTGATTTTGCTTTAGAAGAGGTATCAAGACGGATAGAGTTTGGTTTAGCTTGTTCTTGTATCT
CAGAGGAAGTCTATCAGAAGATCAAGACTCAGAATATAATCAATCCTGGAATCCGAGAAGATTCAAGCACAATACACGGT
GGAGACAAGGTCTCAAGTGCAGTCTTCTTTGAACCTGCAGACCTTGTGGGATATGTGAAGCGTTTAGCATGCTCTCCTAT
CTATGATGCTACTGATGCGCTGCAGCTTGTAAGTCAGAGAGCACAATTATTAGCTTTTAATCGCTGGAAAGGCTACACTG
ACCTCCCTGAGTTTGTGACACTCCAGGGGTCAGTAGAGTCTGCACCCAAGATTTCTCCTGCAGAAGAGAAAAGTAGCTTA
GTGGAAGTCTCTGATCTTGAACCGAAAAAGAGTAAACAAGTTTATACTAAAAGAAGAAAGACAGAAGTCCAAGATGACTG
TAAACACGATGGAGTGTTTGAATATGAAGAAACTACTGTTCCAAAGAAAAAGGAGAAAACTTTGGCAGAGTTCATTGCTG
AGAAACGCTTAAGCAGACATAATAGGAACACATCACATGAAAATTCTGGTAAAGTTCCGCATTGCGAAAAGAAACGCAAG
GTTGTGCAGTCAAAAGTTCCCAAATCCACGAAAAAGATTAAGGAAAACCTGCAAACAGAGGATCCAGGATCACCAATTTC
TCACAAAAATGATCGAAAAAACAGTCTGTCTGCAGGTGATAAGATAACACCAGAGAAAGCTAGAAAAAGTTTCGGAATTG
GGGCAAGCATATTGAAAGTAGCAAACCAGATGCATTGTTCAACACCTACAAGACTCATACCTTGCAGTGATTCGACCTCC
AAAAAGGCAGCCAAGAGCAATGGCAATGGAAAAAGTCTTCAGGAGAAACCTAAAGCCGAAGCATTATCTGCAAGAGAGAT
TTCTCCTTCAACTAATGAAACACTTTCAAGCCCTCACGCTGCTTCTGTTACCAAAACCCCAAGTGGGAAATCCAATTCCA
TCAGCGTAGACCACCAACTATCCGGAGAACTTGAACAGGTCATAAAGGAAGCTCCTAGTACTAACCTTGTGGAGGACCCG
ATGTTGGAGTCTAGGGACTTGAAAGACTCTGCTAAAGAGCAGATGGTACATGAGGATAAGAAAGAAGCTGCAAATATTGC
GGATGAGAAAACTATTATTAAGGACAGCAATCTAATTGGGGAGAAAATCAGTGGCTTGGACTTGAAACAGCAGCCAAACA
AGAACTGCTCTGATAGTTCCAAGGAAGATGTATCTGCAGAGTAG