Details for Lyrate rockcress Locus 16044309

Position : sca3 ( 5`- 6255886 .. 6254091 -3` )
Annotation : [B2G] galactosyltransferase family protein
External links : CoGe
PGDD synteny : 16044309

Protein [Map View]
MPSSPKLFNARPSLFTRRSTPLIVFTSLAIGLTGFLFGLSTILFPGLRLSGRTCLTNLPPKTVKIAWDVVGNSIVNGEVK
RHKVMGFVGIQTGFRSAGRRRALRNTWMPSDPEGLRRLEESTGLAIRFIIGKTKDEAKMAELRREIAEYDDFILLDLEEE
YSKLPYKTLAFFKAAYALYDSEFYVKADDDIYLRPDRLSLLLAKERSHSQTYLGCLKKGPVFTDPKLKWYEPLADLLGKE
YFLHAYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIGAWMLAMNVNHENLHTLCEPECSPYSIAVWDIPKCSGLCNPE
KRMLELHNLESCSKTPTLPSDEE*

DNA
ATGCCATCTTCTCCTAAGCTGTTTAACGCGCGGCCATCACTCTTCACGCGCCGATCGACGCCTTTGATCGTCTTCACCTC
TCTTGCTATCGGTCTAACCGGTTTCCTTTTCGGATTATCCACGATTCTTTTCCCGGGTCTCCGGTTATCCGGCCGGACTT
GCCTCACCAACTTGCCTCCGAAGACGGTTAAAATCGCCTGGGACGTAGTTGGAAATAGTATCGTTAATGGCGAAGTCAAA
AGGCACAAGGTTATGGGATTCGTCGGAATCCAGACCGGATTCAGATCTGCTGGCCGGAGACGAGCTCTCAGGAACACATG
GATGCCGTCCGATCCCGAAGGCCTTCGACGATTGGAGGAATCAACAGGATTGGCCATTAGATTTATTATAGGCAAAACCA
AAGATGAGGCCAAAATGGCTGAGCTTAGAAGGGAAATCGCAGAGTACGATGACTTTATACTGCTAGATCTCGAGGAGGAG
TATAGTAAGCTCCCCTACAAAACTTTGGCTTTCTTCAAAGCTGCATACGCCTTATATGATTCAGAATTCTATGTCAAAGC
TGATGATGATATATACTTGAGGCCAGATCGGTTGTCTTTGCTGTTGGCTAAAGAGCGAAGTCACTCGCAGACATACCTCG
GATGCCTGAAAAAAGGTCCGGTTTTCACAGATCCAAAGCTCAAATGGTATGAACCTTTGGCAGATCTGCTCGGGAAAGAG
TACTTTCTTCATGCTTATGGCCCCATATATGCTCTTTCTGCTGATGTTGTCACTAGTTTGGTTGCCCTCAAGAACAACAG
TTTCAGGATGTTTAGCAATGAGGACGTGACTATAGGTGCGTGGATGCTGGCAATGAACGTTAACCACGAGAACCTTCACA
CCCTTTGTGAACCAGAGTGCTCACCATACTCCATTGCTGTTTGGGATATACCGAAATGCTCAGGGCTCTGTAACCCAGAG
AAAAGGATGTTGGAACTTCACAACCTAGAGAGCTGCTCAAAAACCCCGACTTTGCCATCGGATGAGGAATGA