Details for Lyrate rockcress Locus 16044298

Position : sca3 ( 5`- 7995336 .. 7993643 -3` )
Annotation : [B2G] uracil dna glycosylase family protein
External links : CoGe
PGDD synteny : 16044298

Protein [Map View]
MASSSKTLMDFFQPAKRLKASPSSSSFPAVSVAGGSRGLVSAANSPPRVTVTTSVADDSSGLTPEQVARAEFNKFVAKSK
RNLAVCSEKVTKAKAEGGCYVPLSELLVEESWLKALPGELHKPYAKTLSDFLEREIIADSKSPPIYPPQHLIFNALNTTP
FDRVKTVIIGQDPYHGPGQAMGLSFSVPEGEKLPSSLLNIFKELHKDVGCSIPRHGNLQKWAVQGVLLLNAVLTVRSKQP
NSHAKKGWEQFTDAVIQSISQQKEGVVFLLWGRYAQEKSKLIDATKHHILTAAHPSGLSANRGFFNCRHFSRANQLLEQM
GIPPIDWQL*

DNA
ATGGCTTCGTCATCTAAAACCCTAATGGATTTTTTTCAACCTGCCAAACGCCTCAAAGCTTCCCCTTCTTCCTCCTCTTT
CCCCGCCGTCTCCGTCGCCGGAGGATCCCGTGGTTTGGTTTCTGCAGCAAACTCGCCGCCTCGTGTAACCGTAACCACTT
CCGTCGCCGATGACTCATCTGGCCTTACACCTGAACAGGTCGCTCGCGCCGAGTTCAACAAGTTCGTCGCCAAATCCAAG
CGTAACCTCGCCGTCTGCTCCGAGAAGGTCACAAAAGCGAAAGCTGAAGGAGGCTGCTACGTGCCATTGAGTGAGCTCTT
AGTGGAAGAATCGTGGCTTAAAGCTCTTCCTGGGGAATTGCATAAACCTTACGCCAAAACCCTTTCTGATTTCCTTGAAC
GTGAGATCATCGCTGACAGTAAAAGCCCTCCGATTTATCCACCGCAACACTTGATTTTCAATGCCCTTAATACAACTCCT
TTTGATCGAGTTAAGACTGTCATTATCGGACAGGATCCTTATCATGGACCTGGTCAAGCTATGGGTTTGTCCTTCTCTGT
ACCTGAAGGAGAAAAGCTTCCTTCTAGTCTGTTGAACATATTTAAGGAGCTTCACAAAGATGTTGGCTGTTCTATCCCAC
GTCACGGTAATCTACAGAAATGGGCTGTGCAGGGTGTCTTGCTGCTGAATGCTGTTCTTACAGTACGGAGTAAACAGCCT
AATTCACATGCAAAGAAAGGATGGGAACAATTCACTGATGCTGTTATCCAAAGCATCTCACAGCAGAAGGAAGGTGTTGT
TTTTCTTCTCTGGGGAAGATACGCTCAAGAGAAATCCAAGTTGATAGATGCGACTAAACATCATATACTCACAGCAGCTC
ATCCATCTGGTTTGTCGGCGAATAGAGGCTTCTTTAACTGCAGGCATTTCTCTCGCGCAAACCAGCTTCTCGAGCAAATG
GGGATTCCTCCCATAGACTGGCAACTTTAA