Details for Lyrate rockcress Locus 16044292

Position : sca3 ( 5`- 5862405 .. 5856212 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044292

Protein [Map View]
MRPAIPLDYAVFQLSPKRSRCELFVSTAGSTEKLASGLVKPFVAHLKVAEEQVAREVQSIRLEVESNRNAGTWFTKGTLE
RFVRFVSTPEVLELVSALDVEMSQLEAARKIYGEGTGDQRSSAKDGTETTPAADVTKKELLKAIDLRLAAVRQDLATACN
RASAAGFNPITVSELSQFADRFGANRLNEACTKFITLCQKRPELMSSWRVNQEEEAIRLSWESDMSIDDPSEDPSRDLAT
NRNQQHREYQTGMEEQSATGTNYCQQELKDEEEEKSTVQNEPLVSQPRQLTRRLSVQERISMFENKQKENSGEKTAVAKS
TELKRLSSDLSSSAGMEKVVVRRWSGASDMSIDLGNDRKDDTGDSPLCTPSASSVSKDGSGASSKQFVGYNKKEQNGLSH
AANPPRNEEECTSNNGGDWGMDEVESQNSSSTFLRKDKEVDLKVPLSKNNQVRHQGNSLDGYLEKNSKYKFHEKNSRATS
DYAGNANINDHANNQMSDFISKRQNHIQFRDPQSHSLSTLQQLGGTEPNITSVQSNGGTAESPRKELMPSDRQSPVLEDR
QRKTAVYGGSEQMKRPHSRRTDIGSAAVNTKPSAAINSVSDISESDTLNQLSPTEQVQRARPSKGSQELNDELKVKANEL
EKLFAEHMLRVPGDQTSSVRRGKPGKPSEQAVTSQLRRPVAQDLSSVQISDQKTLAMPTLTSNDEDKFKTPPTKMVVNNE
YGDTTRQNFPEISFSDNSRGKFYEKYMHKRDAKLKEDWSCRRTEKEAKLKVLQDILDRSNAEMKSKFSQSTGRRDSNARR
AEKLVYFNSKLSAKKDQHPISSFQSEEDEDGSRSTQNKKLQQNKNNLLTARTTATSASRSAAKVSTPSAVRRRGQSEKLL
AQTVPNFSEIKKEGMKPASGVGKNGVRTQVRSSIRPKAVNEEEKLRRPKFFRKGAAELASDFSQLKSEDGVSVPLYLEQE
QSGRNFNNHDIGISTDNAQLKASEGSEGSDDMEKEGMGEVLDDTEVEAFTDAEIEMPRLSQESEEWGSTGVANGESFSQL
EPGLNAELPAAMASRHQTMGSILDSPGGSTGPWNTRVKHRYANEASELDASVDSPVGSPAFWNFSSLNQTENDTTQMRKK
WGAAQKRVAGGNPSQNQSQQDVTKGLKRLLNFGRKNRAAESLADWISTTTSEGDDDTDDGRDLANRSSEDLRKSRMGFLQ
SHPSGDSFNESELFNQHVQTTGVPLSFKLKEDQTSGTSVKAPRSFFSLSNFRSKGK*

DNA
ATGAGACCAGCTATACCTCTTGACTATGCTGTCTTCCAACTCTCCCCAAAGCGGTCAAGATGTGAATTGTTTGTCTCTAC
TGCGGGGAGTACTGAGAAACTAGCTTCTGGACTGGTGAAACCATTTGTTGCTCATTTGAAAGTTGCAGAAGAACAGGTTG
CCCGGGAAGTTCAGTCTATCAGGCTAGAAGTTGAAAGTAACAGAAATGCTGGGACCTGGTTTACGAAAGGGACCCTTGAA
AGGTTTGTACGCTTTGTTAGTACCCCAGAGGTTCTGGAATTGGTTAGTGCTTTGGACGTGGAAATGTCTCAGTTGGAGGC
TGCCCGGAAAATATATGGCGAGGGGACTGGTGATCAGCGATCTAGTGCAAAAGATGGCACAGAAACTACACCAGCTGCTG
ATGTGACAAAAAAGGAGTTACTGAAAGCTATTGATTTACGGCTAGCAGCAGTTAGACAGGACTTAGCAACTGCCTGTAAT
CGTGCTTCGGCTGCTGGATTCAACCCTATCACTGTCTCCGAACTTAGTCAGTTTGCTGATCGATTTGGGGCCAATCGCTT
GAATGAAGCATGCACCAAGTTTATAACACTTTGTCAGAAAAGGCCAGAGCTTATGAGCTCTTGGAGGGTCAATCAGGAAG
AAGAAGCGATACGTTTGTCATGGGAATCTGATATGTCAATTGATGATCCCAGTGAAGACCCATCTAGAGACCTGGCGACA
AACAGAAACCAACAACATAGGGAATATCAAACTGGTATGGAAGAGCAAAGCGCAACAGGAACCAACTACTGTCAACAAGA
ATTAAAGGATGAAGAAGAGGAAAAAAGTACGGTACAAAATGAGCCTTTAGTGAGTCAGCCAAGACAACTCACGAGACGGC
TTAGTGTGCAGGAGAGGATCAGCATGTTTGAAAACAAGCAGAAAGAGAACTCTGGAGAGAAAACAGCTGTGGCAAAATCT
ACTGAGCTGAAAAGACTTTCTTCTGATTTATCATCTTCTGCAGGCATGGAAAAGGTTGTGGTACGAAGATGGAGTGGTGC
TAGTGACATGAGCATTGATTTGGGAAATGACAGGAAGGATGATACTGGTGATAGTCCACTGTGCACTCCCTCGGCATCTT
CAGTGTCCAAAGATGGAAGTGGTGCATCCTCGAAACAATTTGTCGGCTACAACAAAAAAGAGCAGAATGGATTGAGCCAT
GCTGCAAATCCTCCTAGGAATGAGGAAGAATGTACTTCCAACAATGGTGGTGACTGGGGAATGGATGAAGTAGAGTCTCA
AAATTCAAGTTCTACATTCTTACGAAAAGACAAGGAGGTAGACTTGAAAGTGCCATTGAGCAAGAATAATCAAGTGAGAC
ATCAAGGAAATTCTCTGGATGGATATTTGGAGAAGAATTCCAAGTATAAATTCCATGAGAAGAATTCCAGAGCCACTTCA
GATTACGCAGGGAACGCAAATATAAATGATCATGCGAACAACCAAATGAGCGATTTTATATCAAAAAGGCAGAACCATAT
ACAGTTTAGGGATCCTCAGAGCCATTCATTGTCTACATTACAGCAGTTAGGTGGTACTGAACCTAATATCACAAGTGTTC
AGAGCAATGGAGGAACTGCGGAGTCTCCTAGGAAAGAACTAATGCCTTCGGATAGGCAATCACCAGTTCTTGAGGATCGC
CAGAGAAAGACAGCGGTTTATGGAGGCTCTGAACAGATGAAAAGGCCGCATAGTAGAAGAACTGATATTGGTTCTGCTGC
TGTAAATACAAAGCCATCTGCAGCCATTAATAGTGTTTCAGATATCTCTGAAAGTGATACTCTGAACCAATTGTCTCCAA
CAGAGCAAGTTCAAAGGGCAAGACCGTCTAAGGGAAGTCAAGAGCTGAATGACGAATTGAAAGTGAAAGCAAACGAGCTT
GAAAAGCTATTTGCTGAACATATGCTCCGTGTGCCAGGGGATCAAACCAGTTCTGTCCGTAGAGGTAAGCCCGGAAAGCC
AAGTGAACAGGCTGTGACTTCACAGCTGAGAAGGCCTGTAGCGCAGGATCTATCATCTGTTCAAATTTCTGATCAGAAGA
CCCTGGCAATGCCAACTTTAACCTCAAACGATGAAGACAAGTTCAAAACTCCGCCAACAAAGATGGTTGTTAACAATGAA
TATGGAGATACCACGAGGCAAAATTTTCCAGAGATCAGCTTTTCGGATAATTCTAGAGGAAAGTTCTATGAGAAATATAT
GCATAAAAGAGACGCAAAGCTAAAGGAAGACTGGAGTTGCAGAAGGACCGAGAAGGAAGCCAAATTGAAGGTGCTGCAAG
ATATACTTGATCGCAGTAACGCTGAGATGAAATCCAAATTTTCTCAGTCTACAGGGAGACGTGATTCAAATGCCCGACGT
GCAGAGAAGCTTGTATACTTCAATTCTAAGTTGAGTGCAAAAAAGGATCAGCATCCAATTAGCTCATTTCAGAGTGAAGA
AGATGAGGATGGTTCCAGGAGCACCCAAAATAAAAAGCTACAACAAAATAAAAACAATTTATTGACTGCTCGAACCACTG
CTACATCAGCGTCACGCTCGGCAGCCAAAGTTTCTACTCCCAGTGCTGTTAGGCGGAGAGGACAATCAGAAAAACTTCTT
GCACAGACAGTCCCTAACTTCTCCGAGATCAAAAAGGAAGGTATGAAACCAGCCTCGGGAGTAGGAAAAAATGGTGTCCG
CACCCAGGTGAGAAGCTCTATCCGCCCCAAAGCTGTAAATGAAGAAGAGAAGTTGCGAAGGCCGAAATTTTTCAGAAAAG
GTGCTGCTGAGTTGGCTTCAGACTTTTCTCAATTGAAGTCAGAGGATGGTGTTTCTGTACCTCTGTATCTTGAACAGGAG
CAAAGCGGGAGAAATTTTAACAATCATGACATTGGTATCAGCACTGATAATGCGCAGCTAAAGGCTTCAGAAGGATCTGA
GGGATCAGATGATATGGAGAAAGAGGGGATGGGAGAAGTACTTGATGACACGGAAGTTGAAGCTTTTACTGATGCAGAAA
TTGAGATGCCAAGACTAAGTCAGGAGTCTGAAGAATGGGGTAGTACTGGGGTTGCAAATGGTGAATCTTTTTCTCAGCTT
GAACCTGGTTTAAATGCTGAATTACCTGCTGCTATGGCTTCTAGGCATCAAACCATGGGTTCAATCCTGGACTCACCCGG
TGGAAGCACTGGTCCATGGAATACGCGAGTGAAGCATCGATATGCAAACGAGGCATCTGAACTTGATGCTTCAGTGGACT
CTCCAGTGGGTAGTCCTGCTTTTTGGAACTTCTCTTCCCTTAACCAGACAGAGAACGATACAACTCAAATGAGAAAGAAA
TGGGGAGCTGCTCAGAAACGCGTTGCTGGTGGTAATCCATCTCAAAATCAGTCACAACAGGATGTGACAAAAGGTTTGAA
AAGGCTTTTAAATTTTGGAAGGAAAAACCGTGCGGCTGAGAGTTTGGCTGACTGGATATCCACTACAACATCTGAAGGGG
ATGATGATACTGATGATGGAAGAGATCTTGCAAATCGATCATCAGAAGACTTGAGAAAGTCGCGAATGGGATTCTTGCAG
AGCCACCCCTCTGGTGATAGCTTCAACGAGAGCGAGCTATTCAATCAACACGTCCAAACCACTGGCGTACCATTGAGCTT
TAAACTGAAGGAGGATCAGACGTCAGGAACTTCTGTAAAAGCACCAAGGTCATTCTTTTCACTCTCCAATTTTCGTAGCA
AAGGGAAATGA