Details for Lyrate rockcress Locus 16044290

Position : sca3 ( 5`- 1680989 .. 1683892 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044290

Protein [Map View]
MVTKTEETQLNQLENQVENGGGGVWEYLCLVRKLKVRRSEIVLKHGLSILNDSGKRSALGPDEWTLYEQVAIAAMDCQSL
GVAQNCIKALQKKFPESKRVGKLEALLLEAKGMWEEAEKAYSSLLEDNPLDQVIHKRKVAMAKAQGKPSLAIEHLNKYLE
VFMADHDAWRELAEIYVSLQMYKQAAFCYEELILTQPTLPLYHLAYADVLYTMGGLENLIAARKYYAATIDLTGGKSTRA
LLGICLCGSAIAQLSKGRNREDKDMAAPELQSLAATALEREYKQKAPAKLNLLTCALRNLKIA*

DNA
ATGGTGACGAAGACGGAGGAAACACAGTTGAACCAACTGGAGAATCAAGTTGAGAATGGAGGAGGAGGTGTTTGGGAGTA
TCTGTGCCTCGTTCGTAAGCTCAAGGTTCGCCGATCAGAGATTGTGCTCAAGCACGGTCTCTCGATCTTGAACGATTCGG
GAAAGCGATCTGCTCTTGGTCCAGATGAATGGACACTGTATGAGCAGGTAGCAATTGCAGCTATGGACTGTCAATCACTT
GGTGTTGCACAGAATTGCATCAAGGCTTTGCAGAAGAAATTTCCAGAGAGCAAACGTGTTGGCAAGCTGGAGGCTTTGCT
GCTAGAAGCAAAGGGAATGTGGGAAGAGGCTGAAAAAGCATATTCGAGCCTGTTGGAGGATAATCCACTTGATCAAGTAA
TACACAAAAGAAAGGTGGCTATGGCCAAGGCACAGGGCAAACCTTCCTTAGCCATTGAACATCTGAACAAATATCTTGAA
GTATTCATGGCTGATCATGATGCCTGGAGAGAACTTGCAGAAATTTATGTTTCCTTGCAAATGTACAAGCAAGCAGCTTT
CTGCTACGAGGAGCTCATACTAACTCAGCCTACTCTTCCATTGTACCACTTAGCATATGCCGACGTTCTCTACACAATGG
GTGGACTAGAAAACCTCATAGCAGCAAGAAAGTACTATGCAGCAACTATAGACTTGACAGGTGGTAAAAGCACAAGAGCA
CTTCTCGGAATATGCTTGTGTGGATCAGCGATCGCACAGCTGTCAAAAGGAAGGAACAGAGAGGACAAGGACATGGCTGC
ACCAGAGCTTCAGTCTCTGGCTGCAACTGCATTGGAGAGAGAGTACAAGCAAAAAGCTCCGGCTAAGCTCAACCTCCTCA
CTTGTGCCTTGAGAAACTTGAAAATCGCTTAG