Details for Lyrate rockcress Locus 16044282

Position : sca3 ( 5`- 22208989 .. 22209372 -3` )
Annotation : [B2G] protein-methionine-s-oxide reductase
External links : CoGe
PGDD synteny : 16044282

Protein [Map View]
MALTIYTCKECGSDLNLNPNDLFPPDFYFEAGNKGTLSFAAVDAEKFRFEKEDKIMPFFETLNYWGIQRKRTKIKCNSCN
HLIGYIYDDGPPLTGGIGQYGFGPSQVIPRAPRYRFKTKAVQVSSQT*

DNA
ATGGCTTTAACGATCTACACTTGCAAAGAATGCGGATCAGATCTGAATCTAAACCCTAACGATTTATTTCCTCCCGATTT
CTACTTCGAAGCCGGTAACAAAGGAACGCTCTCATTCGCCGCCGTCGACGCCGAGAAATTCCGATTTGAAAAAGAAGACA
AGATCATGCCTTTCTTCGAAACCCTAAATTACTGGGGAATCCAACGGAAACGAACCAAGATCAAGTGTAATAGTTGCAAC
CACCTCATCGGCTACATCTACGACGATGGTCCTCCGCTCACTGGTGGTATTGGTCAATACGGATTCGGTCCGAGTCAAGT
CATTCCTCGTGCTCCTCGATATCGATTCAAAACCAAGGCGGTTCAAGTCTCGTCCCAGACTTAG