Details for Lyrate rockcress Locus 16044231

Position : sca3 ( 5`- 22176243 .. 22174186 -3` )
Annotation : [B2G] AtSerat3_1 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16044231

Protein [Map View]
MNGDELPFERGFEVYAKGTHKSEFDSNLLDSRSDPIWDAIREEAKLEAEREPILSSFLYAGILAHDCLEQALGFVLANRL
QNPTLLATQLLDIFYGVMMHDKGIQSSIRHDIQAFKDRDPACLSYSSAILHLKGYHALQAYRVAHKLWNEGRKLLALALQ
SRISEVFGIDIHPAARIGEGILLDHGTGVVIGETAVIGNGVSILHGVTLGGTGKETGDRHPKIGEGALLGACVTILGNIS
VGAGAMVAAGSLVLKDVPSHSVVAGNPAKLIRVMEEQDPSLAMKYDATKEFFRHVADGYRGAQSNGPSLSAGDTEKGHTN
CKS*

DNA
ATGAACGGCGATGAGCTTCCTTTCGAGAGGGGTTTCGAAGTTTACGCTAAGGGAACGCATAAGTCAGAGTTTGACTCGAA
TTTGCTTGATTCTCGTTCTGATCCTATTTGGGATGCTATAAGAGAAGAAGCTAAGCTTGAGGCAGAGAGAGAGCCTATTT
TGAGTAGCTTCTTGTATGCTGGTATCTTGGCACATGATTGTTTAGAGCAAGCTTTAGGGTTTGTTCTAGCCAACCGTCTC
CAAAACCCAACCTTGCTGGCAACTCAACTTTTGGACATATTTTATGGTGTTATGATGCATGACAAAGGTATTCAGAGTTC
GATTCGCCATGATATTCAGGCGTTTAAAGACCGGGATCCTGCTTGTCTCTCGTATAGTTCTGCTATTTTACATCTGAAGG
GGTATCACGCGTTGCAAGCATATAGGGTTGCACATAAACTGTGGAATGAAGGGCGGAAACTATTAGCTCTTGCATTGCAA
AGTCGAATAAGCGAGGTTTTTGGAATCGACATACATCCAGCGGCAAGAATTGGGGAGGGAATATTGTTGGATCATGGAAC
CGGAGTGGTCATCGGTGAGACCGCTGTGATAGGCAACGGTGTCTCGATCTTACATGGTGTGACTTTAGGAGGAACCGGAA
AGGAAACTGGCGATCGTCACCCAAAAATAGGTGAAGGTGCATTGCTTGGAGCTTGTGTGACTATACTTGGCAACATAAGT
GTAGGTGCTGGGGCAATGGTAGCTGCAGGTTCACTTGTGTTAAAGGACGTTCCTTCGCATAGTGTGGTGGCTGGAAATCC
TGCGAAACTGATCAGGGTCATGGAAGAGCAAGACCCGTCTCTAGCAATGAAATACGATGCTACTAAAGAGTTCTTTCGAC
ATGTAGCTGATGGTTACAGAGGGGCACAATCTAACGGACCATCACTTTCAGCAGGAGATACAGAGAAAGGACACACTAAC
TGCAAATCATGA