Details for Lyrate rockcress Locus 16044213

Position : sca3 ( 5`- 7926996 .. 7925494 -3` )
Annotation : [B2G] aspartyl protease family protein
External links : CoGe
PGDD synteny : 16044213

Protein [Map View]
MAFPRFLSLLTTVTLSLFLTATDASSRSLSTSTKTTVLDVVSSLQQTQTILSLDPTRSSLTATKPESISDPVFFNSSSPL
SLELHSRDTLVASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLKPVNNEDTRYQPEALTTPVVSGVSQGSG
EYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFNPTSSSTYKSLTCSAPQCSLLETSACRSNKCLYQVS
YGDGSFTVGELATDTVTFGNSGKINDVALGCGHDNEGLFTGAAGLLGLGGGALSITNQMKATSFSYCLVDRDSGKSSSLD
FNSVQLGSGDATAPLLRNQKIDTFYYVGLSGFSVGGQKVMMPDAIFDVDASGSGGVILDCGTAVTRLQTQAYNSLRDAFL
KLTTNLKKGTSSISLFDTCYDFSSLSSVKVPTVAFHFTGGKSLDLPAKNYLIPVDDNGTFCFAFAPTSSSLSIIGNVQQQ
GTRITYDLANKIIGLSGNKC*

DNA
ATGGCTTTCCCGCGATTTCTTTCTCTCCTCACCACCGTCACTCTCTCTCTTTTCCTCACCGCGACCGATGCTTCCTCTCG
CTCTCTGTCCACTTCAACTAAAACGACTGTACTCGACGTCGTTTCATCTCTCCAGCAAACACAAACTATCCTCTCACTCG
ACCCGACTCGTTCCTCACTCACCGCCACCAAACCCGAATCCATATCCGACCCGGTTTTCTTCAATTCATCTTCACCACTA
TCTCTAGAGCTTCACTCTCGAGACACTCTCGTCGCGTCACAGCACAAAGACTACAAAAGCTTAGTACTGAGTCGACTCGA
GCGTGACTCATCCCGAGTCGCCGGAATCGCCGCAAAGATCCGTTTCGCCGTGGAAGGAATCGATAGATCCGATCTCAAAC
CCGTTAACAACGAAGATACTCGATATCAACCCGAGGCTCTAACGACACCTGTCGTCTCCGGAGTCTCCCAAGGAAGCGGC
GAGTATTTCTCAAGAATCGGAGTCGGAACTCCGGCGAAAGAGATGTACTTGGTTCTCGACACCGGAAGCGACGTGAATTG
GATCCAGTGTGAACCTTGCTCCGACTGTTACCAACAATCCGACCCGGTTTTTAACCCGACTTCATCTTCCACATACAAAT
CACTCACTTGTTCTGCTCCACAGTGCTCTCTTCTCGAAACCTCCGCTTGTCGTTCAAACAAATGTCTCTACCAAGTTAGT
TACGGCGACGGATCTTTCACCGTCGGTGAACTTGCTACCGATACGGTGACGTTTGGTAACTCCGGTAAGATAAACGACGT
CGCTTTGGGTTGTGGCCACGATAACGAAGGTCTCTTTACCGGAGCAGCCGGTTTACTCGGTTTAGGAGGTGGAGCTTTAT
CGATAACCAATCAAATGAAAGCGACGTCGTTTTCGTACTGCCTCGTCGACCGTGATTCGGGAAAATCGTCGAGTCTTGAT
TTCAACTCGGTCCAACTCGGTAGCGGAGACGCGACGGCGCCGCTTCTCCGTAACCAAAAGATCGACACTTTCTACTACGT
CGGACTTAGTGGATTCAGCGTCGGTGGTCAAAAAGTCATGATGCCTGATGCTATCTTCGACGTCGACGCTTCGGGAAGTG
GAGGAGTGATCTTGGATTGTGGAACCGCCGTGACTCGTCTTCAGACTCAGGCTTATAACTCGCTACGTGACGCGTTTCTT
AAACTCACCACGAATCTCAAAAAAGGAACTTCGAGCATCTCTCTGTTCGACACGTGTTACGATTTCTCGTCTCTCTCCTC
CGTGAAAGTACCGACGGTTGCGTTTCATTTCACCGGAGGAAAGTCGCTTGATTTGCCGGCGAAGAATTATCTGATCCCAG
TAGATGATAACGGAACGTTCTGCTTCGCATTTGCTCCGACGTCGTCGTCGTTGTCGATCATCGGAAATGTGCAGCAGCAA
GGGACACGTATCACTTACGATCTAGCGAATAAGATTATCGGATTGTCAGGGAATAAGTGCTAA