Details for Lyrate rockcress Locus 16044192

Position : sca3 ( 5`- 3408328 .. 3409275 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044192

Protein [Map View]
MGFLRCLQLLLLFLSLRLQKLSAQSLPNASSSSSPLDALLQDYSFRAFVRPRTGILYEASTVPSNLTGIKLAAMRLRSGS
FRRRGVTPFKEFSIPSGVIVKPYVTRLVLVYQNLANFSHLYYPLSGYDYVAPVLGLLAYDAKNLSAVNLPQLDLRVSNDP
IRIDFSDLERIPQGSSAKCVRFDSKGEASFSESIQPGNTCETEHQGHFSVVVKSVASAPSPAPPGDRKEKKKKSSESNSK
TWIIVGSVVGGLILLGLLLFLVLRCRNYKKQEKLREMERAGETGEALRMTQVGETRAPTATTTRTQPMLETEYAA*

DNA
ATGGGGTTTCTCCGTTGTCTCCAGTTGCTGCTTCTGTTTCTATCTCTTCGTCTACAAAAGCTCTCTGCTCAATCTCTACC
CAATGCTTCTTCTTCTTCTTCTCCTCTCGATGCTCTTCTTCAAGATTACTCTTTTAGAGCCTTTGTTCGTCCTCGTACCG
GCATTCTCTACGAAGCTTCTACTGTTCCTTCCAATTTGACTGGGATCAAACTCGCTGCCATGAGACTCAGAAGCGGAAGC
TTTAGAAGACGTGGAGTTACTCCTTTTAAAGAGTTCTCAATTCCCAGCGGCGTTATCGTCAAGCCGTATGTGACAAGGCT
TGTATTGGTTTATCAAAACCTAGCTAATTTCTCTCACTTGTATTACCCTTTGTCTGGTTATGATTATGTCGCTCCTGTGT
TGGGTCTTCTCGCTTACGATGCTAAGAATCTCTCTGCGGTTAATTTGCCTCAGCTTGATTTGAGGGTGTCTAATGATCCT
ATCAGAATCGATTTCTCTGATCTGGAACGAATCCCGCAAGGGTCTAGTGCTAAGTGTGTTAGATTTGATTCTAAAGGTGA
AGCGAGTTTCAGCGAATCGATTCAGCCTGGAAACACATGCGAGACTGAGCATCAGGGACATTTCTCAGTTGTGGTGAAAT
CTGTAGCCTCTGCTCCGAGTCCAGCTCCTCCAGGGGATAGGAAGGAGAAGAAGAAGAAGAGCTCTGAATCCAATTCCAAG
ACTTGGATCATTGTTGGGTCGGTGGTAGGTGGATTGATACTGTTGGGGCTTTTACTGTTTCTGGTTTTGAGATGTCGGAA
TTATAAGAAGCAAGAGAAATTGAGGGAGATGGAGAGAGCTGGAGAGACAGGGGAAGCTCTGAGAATGACTCAGGTCGGAG
AAACTAGAGCACCAACTGCTACTACGACTCGTACACAACCAATGCTTGAAACCGAATACGCAGCTTAG