Details for Lyrate rockcress Locus 16044179

Position : sca3 ( 5`- 484228 .. 481030 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044179

Protein [Map View]
MSAKLLYNLSDENPNLNKQFGCMNGIFQVFYRQHCPATPVTVSGDVDKSLPPGERRGSVGEINMESDKETERSSTKKKKS
AAKEKHRVSSESSSRPSFSSSPRSSSFSSAEVSTTASQFDPPGENLIREHPNGGLMMPYDLKELVKGSINREMRTRGEAA
AFTQQQQPNSARTSMLLLKESSLRSPYRSSNEWNEGRGMAMKFKESHRLSYDEREIRNNGFKVGSKLKETPRLSLDSRSN
SFRSPRADAARSSCPEEPATMNHRRSSSSVVAKLMGLEVTADNSDTEQRRENRFCDSPRPMSRVEPALQRSRSVDSIKRI
PASAASKFPMEPAPWKQMKTGDSALTVYGEIQKRLTQLEFKKSGKDLRALKQILEAMEKTQQLIDESRDDSTLNTTTLLQ
RTHQLVPTATSPARNFKSSSIVVMKSAAPVSTSPLPQNVTLPNVKVGNSRQTRKVTSGKQSAMDLTPRPGLCKGQLDSTK
SNSPKTLWSRQASAADAGSMIKSGRSQQHNVSPRTQPKKLGFEKQSRPTTPKSEPGKRQLGKQQTEVASPSRKQLIKPHS
TLQQPDDRLSDASSDLRSLRSDSNISLGSNVDIEVTSRHRLERNCDFPEQHTPKQRNPDFGIKQDRPSLKPLKVTIEQPS
PVSVLDAVFDEEESPSPVRKISLSFKEEDALRSEESEWINKPTSFCRSILFPQSNRAPTKRSSDLFECFPEEGADFKSGN
HKYILEILLASGILRDLEYSMISFQLHQTRLPINSGLFFILEQNKASNVTLPDNKHRGRVFRQQQTNPTEKIRRKLVFDT
VNEILARKFTAEGCIKPRLTANPLKKVEKISKEEQLLQALCSEIDRLQQNNSNCILEDDEEDIIWEDLQSQCMNLKEFEG
ETPGIVLDIERMIFRDLVNEVCFC*

DNA
ATGTCTGCAAAACTTCTGTATAACTTGTCAGATGAGAATCCAAATCTGAATAAACAGTTTGGATGCATGAATGGGATCTT
TCAAGTCTTTTACCGGCAACATTGTCCGGCGACACCAGTCACCGTCTCCGGCGATGTAGACAAGTCTTTGCCTCCAGGGG
AAAGAAGAGGCAGCGTCGGTGAAATCAACATGGAAAGTGATAAAGAAACGGAGAGGAGTAGTACCAAGAAGAAGAAGTCT
GCGGCAAAGGAGAAGCATAGAGTCTCTTCTGAATCCTCTTCGAGACCTTCATTTTCGTCTTCTCCACGCTCCTCGAGCTT
CTCGTCTGCAGAAGTCAGTACCACAGCTTCTCAATTTGACCCGCCTGGTGAGAACCTGATCAGAGAACATCCCAATGGTG
GCCTGATGATGCCGTATGATCTTAAGGAGCTTGTGAAAGGCTCTATTAATAGAGAAATGAGAACTAGAGGCGAAGCAGCT
GCCTTCACTCAGCAGCAGCAGCCCAATTCAGCTCGAACTAGCATGTTGCTTCTCAAAGAATCATCATTGCGTTCACCATA
TCGGAGTTCTAACGAGTGGAATGAAGGAAGAGGTATGGCTATGAAGTTTAAGGAAAGTCACCGGCTTTCTTATGATGAGA
GGGAGATAAGAAACAACGGGTTCAAGGTGGGTTCGAAGTTGAAAGAGACACCGAGGTTGTCTTTGGATAGTAGATCGAAT
TCCTTCAGGAGTCCGAGAGCAGATGCTGCGAGATCGAGTTGTCCAGAGGAACCCGCAACAATGAATCACAGGAGATCAAG
TTCGAGTGTTGTTGCTAAATTGATGGGTCTTGAAGTCACTGCAGACAATTCTGATACTGAACAGAGAAGAGAGAACCGGT
TTTGTGACTCTCCAAGGCCAATGTCCAGAGTGGAACCAGCTCTACAGAGATCTAGAAGCGTAGATTCGATCAAGAGGATA
CCTGCTTCAGCTGCTTCTAAGTTTCCAATGGAACCAGCTCCATGGAAGCAAATGAAAACAGGCGACTCTGCACTGACTGT
ATATGGTGAAATTCAGAAGCGGCTTACGCAGTTGGAGTTCAAAAAGTCGGGAAAAGATCTCAGAGCTCTTAAGCAAATAC
TTGAGGCTATGGAGAAAACACAGCAGTTGATAGATGAAAGCAGAGATGACAGTACTCTGAATACAACCACTCTTTTGCAG
AGAACTCACCAGCTAGTTCCAACTGCAACAAGTCCTGCCAGGAACTTCAAATCTTCATCGATCGTTGTTATGAAATCCGC
GGCTCCAGTTTCCACCTCTCCGCTACCCCAGAATGTCACCTTACCAAATGTCAAGGTTGGAAACTCTAGACAAACCCGGA
AAGTCACCTCGGGGAAGCAGAGCGCGATGGATTTAACCCCAAGGCCAGGCCTTTGCAAGGGCCAACTCGATTCCACGAAG
AGCAATAGCCCCAAAACATTATGGTCCAGGCAAGCTTCGGCTGCGGATGCGGGTTCCATGATCAAGTCAGGTAGAAGCCA
ACAGCACAATGTCAGCCCAAGAACGCAGCCAAAAAAGCTCGGGTTCGAGAAACAGTCTCGACCCACAACTCCAAAATCAG
AGCCAGGCAAAAGGCAACTCGGAAAGCAGCAAACAGAGGTAGCCTCCCCGAGTAGAAAACAGCTGATAAAACCTCACAGT
ACTCTTCAGCAACCTGATGACAGATTGAGCGATGCAAGCAGCGACTTGAGGAGTCTAAGATCTGACAGCAACATAAGCTT
GGGATCGAATGTTGACATCGAGGTTACAAGCAGACATAGGCTGGAGAGGAACTGTGACTTCCCAGAGCAGCACACACCAA
AACAAAGGAATCCGGACTTTGGAATCAAACAAGACAGACCATCCCTAAAACCTCTGAAAGTTACCATTGAACAACCGAGC
CCTGTTTCAGTTCTTGATGCAGTCTTCGACGAAGAGGAGTCGCCGTCCCCTGTGAGGAAGATATCCCTTAGTTTTAAAGA
GGAGGATGCTTTACGTTCTGAAGAATCTGAGTGGATAAACAAGCCTACCAGCTTCTGCAGATCCATACTATTTCCTCAGA
GTAACCGGGCCCCAACGAAGCGAAGTTCTGATCTTTTTGAATGCTTCCCTGAAGAAGGTGCAGACTTCAAAAGCGGCAAC
CACAAGTACATCTTAGAGATATTGTTGGCCTCAGGGATTCTAAGAGATCTTGAATACAGCATGATAAGCTTTCAGCTGCA
TCAAACGCGCCTCCCAATCAACTCTGGACTGTTCTTTATCCTAGAACAGAATAAGGCCAGCAATGTGACTCTACCGGACA
ACAAACACAGAGGCAGAGTATTCAGACAACAGCAGACAAATCCGACAGAGAAAATCAGGAGAAAACTCGTCTTCGACACC
GTTAATGAGATTTTAGCTCGGAAGTTCACTGCAGAAGGCTGTATCAAACCACGTTTAACCGCAAATCCACTCAAAAAAGT
GGAGAAAATATCAAAAGAGGAGCAACTTTTGCAGGCTCTGTGTTCAGAGATTGATAGGTTACAACAAAACAACTCAAACT
GTATCTTGGAGGACGACGAGGAAGACATCATATGGGAGGACCTGCAAAGTCAATGCATGAACTTGAAGGAGTTTGAAGGA
GAGACTCCAGGAATTGTGTTAGATATTGAGAGAATGATTTTCAGAGACTTGGTTAATGAAGTTTGCTTCTGCTAA