Details for Lyrate rockcress Locus 16044169

Position : sca3 ( 5`- 2551036 .. 2551410 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044169

Protein [Map View]
MASLLTLITFIFLSSLSLSSPTTNTISSSPTISPFEEQISPEIAPLLPSPAVSSSTQTIPSSSTLPKPENDDVFADPDPA
FAPSASPPASSLATLSSQAPGVFVYFVVAAVSCFSLRLLAVSPI*

DNA
ATGGCTTCATTGCTAACACTCATCACCTTCATCTTTCTCTCCTCACTTTCTCTCTCTTCGCCGACGACAAACACAATCTC
ATCTTCCCCAACAATCTCTCCCTTTGAAGAACAGATCTCGCCGGAGATCGCTCCTCTCCTCCCTTCACCCGCCGTCTCCT
CCAGTACTCAAACCATCCCTTCTTCTTCAACACTTCCCAAACCAGAAAACGACGACGTTTTTGCAGATCCTGATCCCGCC
TTCGCTCCCTCCGCTTCTCCTCCGGCTTCATCTCTTGCTACTCTGTCTTCTCAAGCTCCCGGAGTTTTCGTCTACTTTGT
CGTCGCCGCCGTCTCTTGTTTCTCGCTCCGGCTTCTTGCCGTTTCACCTATATAG