Details for Lyrate rockcress Locus 16044164

Position : sca3 ( 5`- 3170408 .. 3173928 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044164

Protein [Map View]
MKLTCLSKGDGFHYPPCHMLNLCGFRILIDCPLDLSAIKIFSPVISCVASEASKYPSDESLDAQNPIQKKHKLERQLTFA
DLVCEEPWYKTVKPLHLWDASFIDIVLISNPMGLLGLPFLTQNPGFSAKIYMTEATAKIGQLMMEDLVSMHAEFRCFHGP
DNSSFPGWIKNLDREQVPALLKKVVFGESGDDLGSWMRLYSLDDIESCMKKVQAVKFAEEVCYNGTLIIKALSSGLDIGA
CNWLINGPNGSLSYVSDSIFVSHHARNFDFHGLKGTDVLIYSDFSSLQSAEVTENGCISPDPDNNYISTTSDNKDSLLNT
EDSLEEMEKLEFICSCAAESADAGGSTLITITRIGIVLQLLELMSNSLESSSLKVPIFVISSVAEELLAYTNTIPEWLCE
QQQEKLISGEPSFGHLKFIKDKKIHLFPAIHSPNLIYANRTSWQEPCIIFAPHWSLRLGPSVQLLQRWRGDPKSLLVLED
GISSGLGLLPFRPIAMKILQCSFLSGIRLQKLPTLLSVLQPKIVLVPDAVNQRINFAAMKTISILNYFENKTLRVPRIAD
NPSVEITTDLASKLSWRKLRQRENFGIARLKGGLLMEDGKHRLVSGLEQEESSGKARPLRHWGSVAPESLLDALLKIGIK
GSLEQSIGETGSDDNSIIHIANPSSGLIEVSEMGTAIITDDENVASQVFQAIDGILDGI*

DNA
ATGAAATTGACATGTCTGAGCAAAGGAGATGGCTTTCATTATCCGCCTTGTCATATGCTGAATCTATGTGGTTTCAGGAT
ATTGATTGATTGCCCTTTGGACCTTTCGGCAATCAAAATCTTCTCACCTGTTATATCTTGTGTGGCTTCTGAAGCTTCTA
AATATCCATCTGATGAGTCGTTGGATGCTCAGAATCCAATTCAAAAGAAGCATAAACTGGAGAGACAGCTAACTTTTGCT
GATTTGGTGTGTGAAGAACCGTGGTACAAAACTGTGAAACCCTTGCATTTGTGGGATGCTTCTTTCATTGATATTGTTCT
CATCTCCAACCCTATGGGATTGCTCGGATTGCCATTCCTTACCCAAAACCCTGGATTTTCTGCCAAGATATATATGACTG
AAGCAACAGCGAAGATTGGACAGCTCATGATGGAAGATCTTGTCTCGATGCACGCGGAATTCAGATGTTTTCATGGACCT
GACAACTCCAGTTTCCCTGGGTGGATAAAGAATTTAGATCGTGAACAAGTACCAGCCTTGCTTAAAAAAGTTGTCTTCGG
CGAGAGTGGTGATGATCTGGGCAGTTGGATGCGTCTGTACAGTTTAGATGATATAGAGAGTTGCATGAAGAAGGTTCAAG
CCGTAAAGTTTGCAGAAGAAGTATGTTATAATGGGACCTTAATCATTAAGGCTCTAAGTTCAGGTCTAGATATTGGGGCT
TGCAATTGGTTGATCAACGGACCTAATGGAAGTCTAAGTTATGTCTCAGATTCCATCTTCGTTTCACATCATGCAAGAAA
TTTTGATTTCCATGGTCTCAAAGGAACCGATGTGTTGATTTACTCAGATTTCTCATCCCTCCAATCTGCAGAAGTGACTG
AGAATGGTTGTATTTCTCCTGACCCAGATAATAATTATATATCAACAACCAGTGACAACAAGGATTCATTACTAAACACT
GAAGACAGCTTAGAAGAGATGGAGAAACTAGAGTTTATTTGTTCATGTGCTGCAGAATCTGCTGATGCTGGTGGCTCAAC
CTTAATAACGATTACTAGAATCGGTATAGTTCTGCAGCTCCTAGAGCTAATGTCAAATTCTCTTGAATCCTCGTCTCTAA
AGGTTCCAATTTTTGTAATATCTTCTGTGGCAGAAGAGTTATTGGCATACACAAACACCATACCCGAGTGGCTGTGCGAG
CAACAACAGGAGAAGTTAATTTCAGGAGAACCATCATTTGGCCATCTTAAATTCATTAAAGACAAGAAGATCCATTTGTT
TCCTGCCATTCATTCACCCAACTTAATTTATGCGAACAGAACGAGTTGGCAGGAACCATGCATCATATTTGCTCCTCACT
GGAGTTTGCGACTTGGCCCTTCTGTCCAACTTCTTCAGCGTTGGCGTGGAGATCCAAAATCATTGCTTGTTCTTGAGGAT
GGGATTAGTTCAGGTTTAGGACTTCTCCCTTTTAGACCGATAGCAATGAAAATTCTCCAATGTTCATTTCTTTCTGGAAT
AAGGTTGCAAAAGCTCCCAACACTTCTTTCCGTTTTGCAGCCAAAGATTGTCTTGGTCCCTGATGCTGTCAATCAGAGGA
TCAATTTTGCTGCAATGAAGACAATATCAATCCTGAATTACTTTGAAAACAAGACGCTACGTGTACCAAGAATTGCAGAC
AATCCAAGCGTAGAGATTACGACAGACTTGGCCTCCAAATTGAGCTGGAGAAAACTGAGACAACGTGAAAACTTTGGTAT
TGCAAGATTGAAAGGTGGGCTTCTGATGGAAGATGGGAAACACAGATTAGTTTCAGGGTTGGAGCAGGAAGAAAGTTCAG
GAAAGGCTCGGCCATTGAGGCATTGGGGCTCAGTGGCTCCGGAATCACTTTTAGACGCTTTACTGAAAATCGGAATAAAA
GGATCCTTAGAACAGAGCATAGGTGAGACTGGATCAGACGACAACAGTATAATCCATATAGCAAATCCTAGCAGTGGCCT
GATAGAGGTCTCAGAGATGGGTACTGCTATTATAACAGACGATGAGAATGTAGCCTCTCAGGTCTTCCAGGCGATTGATG
GAATTCTTGACGGTATTTAG