Details for Lyrate rockcress Locus 16044129

Position : sca3 ( 5`- 8489344 .. 8487252 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044129

Protein [Map View]
MAELRSGVLFKLLEEMGVGKVRRDVDHRPVLLQIRSIIPVLAAGGLWPNKGFFLRITDSTHSMYVSLPREENDLVLYDKL
QIGQLIFIEKLEFAYPVPMIKGIRPTPGRRACTGDPIDLIPKERIEKFCVGLSDMEENYDHQVKKPRRTRWNNSSVSELN
FTDLGLSKNLSSVMEEKDDTESMISSCSSSFSSVARRRSWIGSGDNRKRRESLDPSMIKNHDHDTKHASIARSSSATSPS
LSIRSYGGIEEKSSSRTRRRDGVVSPSPRWSKSLSYGSGSNKSKNLLPPKSNTLESSDSISRKRSWTETEILWDSLPPKV
VNLGKEILRQRDTAIRAASQALLEASAAERLLKCLRSYSELSDRRNQHQENQQPPIQDFLSFQAELSKSRLIIQSLSTEK
TEHSNSNIVKTGDERREKATQWIKSALATDLQLVSSTASKPTQSPGRKGLTLIAQEIDNREDNTSESDSGLGERKERLSR
ASSELRNWLKEEGRSWYLSRVEKYLDEISNGTKWREMSSQQVGETMYQIKRVSDWLDAIVKGEENEEEEEMVMMMMSEFE
TEACGRVRNKIYRILLKHVETTSLLSHQRSTNLMSNQQQQQQQQHLFQKTMSL*

DNA
ATGGCAGAACTAAGATCAGGTGTTCTTTTCAAGCTTCTAGAAGAAATGGGAGTCGGGAAAGTGCGAAGAGACGTCGATCA
CAGACCGGTTTTGCTGCAGATAAGAAGCATAATCCCTGTGTTAGCAGCTGGAGGATTATGGCCAAACAAAGGTTTCTTCT
TGAGGATAACAGATTCAACACACTCAATGTATGTATCATTGCCGCGAGAAGAGAACGATCTTGTTCTTTACGACAAGTTA
CAAATCGGGCAATTGATATTCATCGAGAAGCTTGAATTTGCTTATCCAGTTCCTATGATCAAAGGCATTAGACCAACTCC
AGGCCGAAGGGCTTGCACCGGTGATCCAATCGATCTAATCCCTAAAGAACGGATCGAAAAGTTCTGTGTCGGTCTATCGG
ATATGGAAGAAAACTATGATCACCAAGTGAAGAAGCCAAGAAGAACGAGATGGAATAACTCAAGCGTCTCTGAGTTAAAT
TTTACAGATTTGGGGTTATCGAAAAACCTTTCGAGTGTTATGGAAGAAAAGGATGATACAGAGTCAATGATTTCGAGTTG
CTCTTCGTCTTTTTCTTCAGTAGCTAGGAGAAGAAGCTGGATAGGCTCAGGTGATAATAGGAAGAGAAGAGAGTCGTTAG
ATCCATCCATGATTAAGAATCATGATCATGACACTAAACATGCTTCAATTGCTCGAAGTTCTTCCGCTACTTCACCTTCG
CTGTCTATCCGAAGCTATGGAGGGATAGAGGAGAAATCAAGTAGTAGAACAAGAAGAAGAGATGGTGTGGTTTCACCATC
TCCAAGATGGTCTAAAAGCTTAAGCTATGGAAGTGGAAGTAATAAGAGTAAGAACCTTCTTCCACCTAAAAGCAATACCC
TTGAATCCTCAGATTCGATATCGAGGAAAAGAAGCTGGACAGAGACAGAGATTCTCTGGGATTCACTTCCTCCAAAAGTT
GTAAATCTCGGAAAGGAAATTCTGAGACAGAGAGATACGGCTATTCGAGCTGCATCCCAAGCTTTGTTAGAGGCTTCAGC
TGCTGAAAGATTGCTCAAATGTCTAAGGTCATACTCGGAGCTTTCGGACAGGAGAAACCAACATCAAGAAAATCAACAGC
CACCAATTCAAGATTTCTTGAGTTTCCAAGCTGAGTTAAGCAAGAGCAGGCTCATCATTCAATCACTATCAACTGAAAAA
ACAGAGCATTCCAACTCCAACATAGTCAAAACAGGAGATGAGAGACGCGAAAAGGCGACTCAGTGGATCAAATCAGCATT
AGCTACCGATCTCCAACTGGTTTCTTCTACCGCAAGTAAGCCTACACAGAGCCCCGGGAGAAAGGGTCTTACCCTAATTG
CTCAAGAAATTGATAACCGTGAAGATAACACAAGCGAAAGCGACTCGGGATTGGGAGAGAGAAAGGAGAGGTTAAGCAGA
GCATCGAGCGAACTTAGAAACTGGCTTAAGGAAGAAGGAAGAAGTTGGTATCTAAGCCGTGTTGAGAAGTATTTAGATGA
GATCAGCAATGGAACAAAGTGGAGAGAAATGAGCAGTCAACAAGTAGGGGAAACTATGTATCAGATAAAACGAGTGAGTG
ATTGGTTAGACGCCATTGTTAAAGGAGAAGAAAATGAGGAAGAAGAAGAAATGGTGATGATGATGATGTCAGAGTTTGAA
ACAGAGGCTTGTGGTAGAGTGAGGAACAAGATTTATAGGATTCTTTTGAAACATGTTGAGACAACTTCTTTGTTAAGTCA
TCAACGTAGTACCAATCTCATGTCTAATCAACAACAACAACAACAACAACAACACTTGTTCCAAAAGACGATGTCACTTT
AG