Details for Lyrate rockcress Locus 16044124

Position : sca3 ( 5`- 3009074 .. 3008333 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044124

Protein [Map View]
MAGDTARRKIKLFCPSVSKIVEWVAWNDEKIDFRAIAAAFGLEPSTVKLNGHFISRGFDLIATCVTWHSLLTFFSARGLS
TGKHEADALLVHGKLSKLGTKRAHSDPQEDLIKTKKLKDKCSVEESPISGCNKRKLLSQDSHSLKKLKLNMDDSFGGSGS
KTPLKCSFISDNGLKRTRDDDMIASASCKKIR*

DNA
ATGGCGGGAGACACAGCTCGGAGGAAGATCAAACTTTTTTGTCCCTCGGTATCGAAGATTGTGGAGTGGGTTGCTTGGAA
CGACGAGAAAATAGACTTTAGAGCCATAGCCGCAGCGTTTGGGCTCGAACCATCGACGGTGAAGCTCAATGGTCACTTCA
TTAGCAGAGGTTTTGATCTAATCGCCACTTGTGTGACGTGGCACTCTTTGCTCACTTTCTTCTCTGCTAGAGGCTTGTCT
ACTGGTAAACACGAAGCCGATGCTCTGCTAGTTCACGGCAAGCTCTCTAAACTCGGTACTAAAAGGGCACACTCTGATCC
TCAGGAGGACTTAATCAAAACGAAGAAGTTGAAAGATAAGTGTTCAGTTGAAGAATCACCCATCTCTGGATGCAACAAGA
GAAAGCTTTTGTCTCAAGATTCTCACTCGCTCAAGAAACTAAAACTCAACATGGATGATAGTTTTGGAGGGAGCGGTTCT
AAAACGCCGTTGAAATGCAGTTTCATAAGTGATAATGGTCTGAAGAGGACAAGAGACGATGATATGATTGCTTCTGCATC
TTGTAAGAAGATAAGATGA