Details for Lyrate rockcress Locus 16044095

Position : sca3 ( 5`- 3574716 .. 3575729 -3` )
Annotation : [B2G] legume lectin family protein
External links : CoGe
PGDD synteny : 16044095

Protein [Map View]
MAMSKTLSFLFLLCFQIHGTMSAAENSSFSFNGFAISPSFDKSVALFGDSKLVNDSSLIQLTDSVTRSVGRVVYKKPINL
FQGKQRNSRSFSTHFSFSSMSSEISDGALAFVMVPTSLDLSLFGNKDNSSSALGFLSQYAKNETVFAVEFDISKRGNCAR
ILIGRPESAQIRNLSFVGDLMMDNGGTLNCMIEYEASSKRMMVRFRKPGSIKLLDPFFSFSVDLAKLWKGGEVTVGLSSA
NGNSSSKAHFLHSWSFEIRHPPPMWMHSVPLEPNEVSKEEDGRGRSECIWKMLGALFFGAACGALGTMLALYIWTICRVR
RSMAVVPEECAIEQGKK*

DNA
ATGGCCATGTCCAAAACCTTATCTTTTTTGTTCCTCTTATGCTTTCAGATACATGGAACGATGTCTGCAGCTGAAAATTC
CTCGTTTTCATTCAATGGGTTTGCTATATCTCCCAGTTTTGACAAGAGTGTTGCTCTGTTTGGGGATTCGAAGCTGGTCA
ATGACAGTTCTTTGATTCAGCTGACTGATTCAGTGACTCGAAGCGTTGGACGAGTCGTTTACAAGAAACCCATCAATCTT
TTCCAAGGTAAACAGAGGAATTCGAGATCTTTCTCGACTCACTTCTCGTTTTCTTCCATGTCCAGTGAGATTAGTGATGG
TGCCTTGGCTTTTGTAATGGTTCCAACTAGTTTGGATCTTAGTCTGTTTGGTAACAAGGACAACAGTTCCTCTGCTTTAG
GGTTCCTATCACAATATGCAAAGAACGAGACAGTTTTTGCTGTTGAGTTTGATATCTCCAAGAGAGGAAACTGTGCAAGA
ATCTTAATTGGTAGACCTGAATCTGCCCAAATTAGAAACCTTTCCTTTGTGGGTGACTTGATGATGGACAATGGAGGGAC
TTTGAACTGTATGATTGAGTATGAGGCAAGTTCTAAGAGAATGATGGTTCGATTCAGAAAACCTGGTTCGATAAAGCTGT
TGGATCCATTCTTCTCTTTCTCAGTAGACTTGGCCAAGTTATGGAAAGGTGGTGAAGTCACTGTGGGTTTAAGCTCTGCC
AATGGGAACTCTTCTTCCAAGGCACATTTTCTCCATTCATGGAGCTTTGAAATAAGGCATCCTCCTCCGATGTGGATGCA
TTCAGTGCCGCTTGAACCGAATGAAGTTTCAAAGGAGGAAGATGGTCGAGGGAGAAGTGAGTGTATATGGAAAATGCTTG
GTGCTTTGTTTTTTGGTGCTGCTTGTGGAGCCTTAGGGACAATGCTTGCTTTGTATATCTGGACGATATGCCGTGTTAGG
CGGTCAATGGCCGTGGTTCCTGAGGAATGTGCTATTGAACAAGGCAAGAAGTAG