Details for Lyrate rockcress Locus 16044082

Position : sca3 ( 5`- 3160122 .. 3160955 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044082

Protein [Map View]
MFMCCVATVEGNSLPEEDVEMMENSDGMKTVESFPMVEPFIGMKFESEEAAKSFYDNYAICMGFVMRVDAFRRSMRDGTV
VWRRLVCNKEGFRRSRPRRSESRKPRAITREGCKALIVVKREKSGKWVVTKLEKEHNHPLLPLSPNVRRNPPLPQTPDEK
DAKIRELSAELSRERRRCTALQQQLDMVLKEMEEHSNHLSVNINNVIQSVRQIESNTFTKPLS*

DNA
ATGTTTATGTGTTGTGTTGCGACAGTGGAAGGGAACTCTTTACCCGAAGAAGATGTAGAGATGATGGAGAATTCAGATGG
AATGAAGACAGTTGAATCTTTTCCAATGGTGGAGCCATTCATTGGTATGAAGTTTGAATCAGAAGAGGCTGCAAAGTCTT
TCTATGACAATTACGCCATATGCATGGGTTTCGTTATGCGAGTGGATGCTTTCAGGAGGTCGATGCGAGATGGGACTGTG
GTGTGGCGCCGACTGGTGTGTAATAAAGAAGGATTCCGTAGATCTAGACCCCGGAGAAGTGAGAGCAGGAAACCTCGGGC
TATAACAAGAGAAGGGTGTAAAGCTCTGATTGTGGTGAAAAGAGAGAAATCCGGAAAATGGGTTGTCACTAAATTAGAGA
AAGAACATAATCATCCTCTCTTGCCTCTCTCGCCTAATGTTCGCCGGAATCCTCCGCTCCCTCAAACACCGGACGAGAAA
GACGCGAAGATTCGGGAGCTGAGTGCAGAGCTGAGCCGAGAGAGAAGGCGTTGTACTGCTTTGCAACAGCAGCTTGATAT
GGTCCTCAAGGAGATGGAAGAACATTCCAACCATCTCTCCGTTAACATCAATAATGTTATCCAAAGTGTTAGACAAATTG
AGTCCAATACTTTCACTAAACCCCTTAGCTGA