Details for Lyrate rockcress Locus 16044060

Position : sca3 ( 5`- 4734492 .. 4732803 -3` )
Annotation : [B2G] u-box domain-containing protein 24
External links : CoGe
PGDD synteny : 16044060

Protein [Map View]
MDHEEEEIEIPNYFICPISLEIMKDPVTTVSGITYDRQSIVKWLEKVPSCPVTKQPLPLDSDLTPNHMLRRLIQHWCVEN
ETRGVVRISTPRAPPGKLNVVEEIKNLKGFGQEALGREETLQKLEVLAMEGNNRRLMCEAGVHKSLILFVVKCTSEDEEG
RRRIKGLDQSLRLLHLIGVPSNDAKTILIENDRIMESLTWLLHQEDFFNRAYTIVILKNLMEHTSSHIVERLNPEIFKGI
IEFLKDVVSSLNRTSPTVRDTVQSSRPSLGKKEPLKLDHSLVIKQAVTAALMILLETSSWSRNRSILVDLGAVSELIELE
MSYSGEKRITELMLGVLSRLCCCANGRAEILSHRGGIAVVTKRLLRVSPVADDRAISILSTVSKFSPENMVVEEMVNVGT
VEKLCSVLGMDCGLNLKEKAKDILKDHFDEWKKFPCIDITLLTKLLSSSPKDPLTEFNSRVGV*

DNA
ATGGATCATGAAGAGGAAGAGATCGAGATTCCTAATTACTTTATTTGCCCAATCTCACTTGAGATCATGAAAGATCCAGT
CACGACCGTTTCTGGCATCACTTACGACCGTCAAAGCATCGTTAAATGGCTCGAAAAGGTCCCTTCTTGTCCTGTCACGA
AGCAACCCCTTCCCTTAGACTCCGATCTTACACCTAACCACATGCTTCGCCGTCTGATCCAACATTGGTGCGTTGAGAAC
GAGACTCGTGGCGTTGTCAGAATCTCTACTCCTCGAGCTCCTCCTGGAAAACTTAACGTCGTCGAGGAGATCAAAAATCT
CAAAGGGTTCGGCCAAGAAGCCTTAGGAAGAGAAGAAACGTTGCAGAAGCTTGAAGTTTTGGCAATGGAGGGAAATAACA
GGAGATTGATGTGTGAAGCAGGCGTGCATAAGTCTTTGATCTTGTTCGTAGTCAAGTGTACTAGTGAAGACGAAGAGGGA
CGACGTCGTATCAAAGGGCTAGATCAGTCTCTTCGTCTTCTTCACTTGATCGGTGTTCCATCAAACGACGCAAAAACAAT
TTTGATCGAAAACGATCGAATCATGGAATCGTTGACTTGGCTTTTACACCAAGAAGACTTCTTCAATAGGGCTTATACAA
TTGTGATCTTAAAGAATCTAATGGAACACACTTCCTCTCATATTGTAGAGAGATTGAATCCCGAGATTTTTAAAGGGATC
ATAGAGTTTCTCAAGGATGTAGTAAGCAGTCTTAATCGGACGAGCCCTACCGTGAGAGATACGGTTCAATCATCAAGGCC
TAGCTTGGGAAAAAAGGAACCATTAAAACTTGATCATAGTTTGGTCATTAAACAAGCGGTGACTGCCGCGCTGATGATTC
TTTTAGAGACTTCTTCGTGGAGCCGAAACCGATCGATCCTTGTGGATCTCGGTGCGGTTTCTGAACTCATCGAACTGGAA
ATGAGCTACTCAGGCGAGAAAAGAATCACAGAACTTATGTTAGGAGTTTTGTCTCGTTTATGTTGTTGCGCCAACGGTAG
AGCCGAGATTCTTTCTCATAGGGGCGGAATCGCGGTTGTGACGAAGCGGCTATTGAGGGTTTCACCTGTAGCAGACGATA
GAGCTATCTCTATCCTAAGTACAGTGTCAAAATTCTCGCCGGAAAACATGGTGGTGGAAGAGATGGTAAACGTTGGGACG
GTAGAGAAGCTTTGTTCCGTTCTAGGAATGGATTGTGGTTTGAACTTGAAGGAGAAAGCAAAAGATATACTTAAAGATCA
TTTTGATGAGTGGAAGAAGTTTCCGTGTATCGATATAACTCTTCTCACTAAGCTTCTAAGCTCTTCACCCAAAGATCCAC
TCACCGAGTTTAACTCCCGAGTTGGTGTTTAG