Details for Lyrate rockcress Locus 16044021

Position : sca3 ( 5`- 9622159 .. 9623304 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044021

Protein [Map View]
MDTFSCNSYEQNHPHDDDIDIDAHDHDSHGGDHQEESGWTTYLDDFSNQYRTTHHEESDHQEKSSCSLLGASTSLVSDAA
THAFSGKSFPVNFPANLKFGRGRTKKICEDDSLEDTASSPVNSPKVSQFEHIQTPPRKIEDYVSSSFVMGNIRGMRDHQI
QIQEGDEQKMTLMRNLIEENNNNNNNNNNNNMDLRSRGLCVVPISMLANFNGRC*

DNA
ATGGATACATTCTCTTGTAATTCTTATGAACAAAACCACCCACATGATGATGATATTGATATTGATGCTCATGATCATGA
TTCTCATGGTGGTGATCATCAAGAGGAGAGTGGATGGACAACTTATCTTGATGATTTCTCAAATCAATACAGAACTACTC
ATCATGAAGAAAGTGATCATCAAGAAAAGAGTTCTTGTTCACTTCTTGGCGCCTCTACTTCCCTGGTCTCTGACGCCGCC
ACCCATGCCTTTTCCGGCAAGAGTTTTCCCGTTAATTTTCCGGCAAATTTGAAGTTTGGGAGGGGAAGAACCAAAAAGAT
TTGTGAGGATGATTCTCTGGAGGACACGGCTAGCTCTCCTGTCAACAGCCCTAAGGTCAGTCAGTTTGAACATATTCAGA
CGCCTCCTAGAAAAATTGAGGACTATGTCTCTTCTAGTTTCGTTATGGGAAATATTAGAGGCATGAGGGATCATCAAATC
CAAATACAAGAAGGTGATGAACAAAAAATGACGCTGATGAGAAATCTCATTGAAGAAAACAACAACAACAACAACAACAA
TAACAATAACAATATGGATTTGAGGAGTAGAGGATTATGCGTCGTCCCTATCTCCATGTTGGCTAATTTTAACGGTCGCT
GCTGA