Details for Lyrate rockcress Locus 16044013

Position : sca3 ( 5`- 8337116 .. 8335400 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16044013

Protein [Map View]
MAPNYNPSIFLILSLHFLSILATGNNHITDRKSLEIIFGGGSESFNYNSPAPSPEPEDYLPPPPPRPQIPSPLPPPQPLP
PLFPSPEPENCRPPPYHHYLTPSPPPPRPLAPPLPPPLLFSSPLIKNVYSVIKNFQTLIENDPKKILRTWVGTDICAQDK
YIGLECAKFPGTNDLALASIQFNNFNLGGKKLRLDNFLNKLEEVTIFHANSNSFVGSVPKFSNLKYLFELDLSNNKLSGE
FPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINNNNLVQRLPENLGSITALYLTFANNRFTGPIPGSIGDIKS
LQEVLFLNNKLTGCLPYQIGNLNRATVFDVESNQLTGLIPYSFGCLNKMEQLNLARNNFYGTIPEIVCELSALKNLSLSS
NYFTQVGPKCRTLIKRKILDVGMNCILDLANQRAPWECAKFFLRKQSCPNYKSFFYVPCGKDPHRIKPDQEGLDGQASPP
VSYGALNPDRIRNL*

DNA
ATGGCCCCAAATTATAATCCTTCCATTTTCTTGATTCTGTCTCTTCACTTTCTTTCAATTTTAGCTACCGGAAATAACCA
CATAACTGACAGAAAATCTCTCGAAATCATCTTCGGCGGTGGCAGTGAAAGCTTCAATTACAATTCTCCGGCGCCATCTC
CGGAGCCAGAAGACTATCTTCCGCCGCCTCCTCCTCGACCTCAAATACCATCACCCCTGCCTCCACCACAGCCACTTCCT
CCTCTATTCCCATCTCCGGAGCCTGAAAACTGTCGTCCGCCACCTTATCATCATTATCTAACACCATCTCCGCCGCCACC
ACGGCCACTTGCTCCTCCACTGCCACCACCACTACTGTTCTCCAGCCCACTAATAAAGAACGTTTATTCAGTCATCAAGA
ATTTCCAGACGCTAATCGAAAATGATCCAAAGAAGATACTCAGAACATGGGTAGGCACCGACATTTGCGCTCAGGACAAA
TATATAGGACTAGAGTGCGCCAAGTTCCCGGGAACAAACGACCTCGCACTTGCCAGCATTCAGTTCAACAACTTTAACTT
GGGAGGCAAGAAACTCCGCCTAGATAACTTCCTTAACAAGTTAGAAGAAGTCACCATCTTCCACGCAAATAGTAACAGTT
TCGTGGGCTCTGTTCCAAAATTCAGCAACTTGAAGTACCTTTTCGAGCTTGATCTCAGCAACAATAAGCTCTCTGGAGAG
TTCCCAAGCTCTGTACTAAAAGCAACAAACCTAACGTTTCTCGATCTCAGATTCAATTCTTTCTCCGGTTCTGTACCTCC
TCAGGTTTTCAATCTCGACCTGGACGTATTGTTCATCAACAACAACAATCTTGTTCAGAGACTCCCTGAGAATCTCGGAT
CCATCACTGCTCTTTACCTCACATTCGCTAACAACAGATTCACAGGTCCTATTCCGGGAAGCATTGGTGACATCAAGTCC
CTACAAGAAGTCCTTTTCTTGAATAACAAGTTAACAGGTTGCTTACCATACCAAATTGGGAACCTTAACCGAGCTACGGT
TTTCGATGTTGAGTCAAACCAGTTAACCGGTCTGATTCCGTACTCTTTCGGATGCCTAAACAAGATGGAGCAGCTCAATT
TGGCTAGAAACAACTTCTACGGTACTATACCGGAGATTGTCTGCGAGCTCTCAGCCCTCAAGAACCTTTCTCTCTCGTCC
AATTACTTCACGCAGGTAGGTCCAAAATGTCGAACACTCATCAAAAGGAAGATTCTTGATGTGGGTATGAATTGTATACT
AGATCTTGCGAATCAAAGAGCACCATGGGAATGCGCCAAGTTTTTCTTGCGGAAACAGAGTTGTCCTAACTATAAGTCTT
TCTTTTATGTCCCTTGTGGAAAAGATCCGCACCGGATTAAACCAGATCAAGAAGGATTAGACGGTCAGGCTTCGCCGCCG
GTATCTTATGGTGCTCTTAACCCAGACCGGATTCGGAATCTCTAG