Details for Lyrate rockcress Locus 16043985

Position : sca3 ( 5`- 4667028 .. 4667591 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043985

Protein [Map View]
MHALTNSGAVLLAVLLFFLLVLLAELSYIFCRRTGSLPSPASKEVIFQFLMCCKKNHHSRIEPSTGIVSVQMEEDVVAAA
APEEDLFAVDKWRVSRLLFTIEEEDLELEDEDDDVVSAKEDNDGELRVDIPVEYSGDPTPFLTPCDSPPYFTPSPSPGRD
MDDVIDVYDVNSRNRNCCFNFQGSQMC*

DNA
ATGCATGCCCTCACCAACTCCGGCGCCGTACTTCTCGCCGTGTTACTCTTCTTCCTCCTCGTTCTCCTCGCCGAGCTCTC
TTACATCTTTTGTCGCCGCACCGGATCTTTACCGTCTCCGGCAAGTAAAGAGGTTATTTTCCAATTCTTGATGTGTTGCA
AGAAGAACCACCACTCTCGTATTGAGCCAAGTACCGGAATTGTTTCTGTACAGATGGAGGAGGATGTTGTTGCTGCGGCG
GCGCCGGAAGAGGATTTGTTTGCGGTGGACAAGTGGCGAGTGTCGAGGCTTCTCTTCACAATCGAGGAAGAGGATTTGGA
ACTGGAAGATGAAGATGATGATGTGGTCTCTGCGAAGGAGGATAATGACGGCGAACTCCGAGTTGACATTCCGGTGGAAT
ATTCCGGCGATCCAACTCCGTTCTTGACGCCGTGCGACTCACCTCCTTACTTCACTCCTTCGCCATCTCCTGGTCGGGAT
ATGGATGACGTCATTGATGTTTATGACGTCAACAGCAGAAACAGAAACTGTTGTTTCAATTTCCAAGGCTCTCAGATGTG
TTAA