Details for Lyrate rockcress Locus 16043983

Position : sca3 ( 5`- 955907 .. 957013 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043983

Protein [Map View]
MLGAIHFGVLAACFVLFVPMAMAGWHLSRNKMLFFSGALFISLAVCVHLTPYFPSVSDIVASVSSVVVYDHRISCINEVN
QIVWDVKPVTNPDSVRRNNGSTKLDYFDKNWDWIKSRKVLSCEFQKLDKFDVSDLLNGSWVVVAGDSQARFVALSLLNLV
LGSDSKAMDSVRGDLFKRHSDYSIVVKEIGMKLDFVWAPYEKDLDDLVVSYTKMKKYPDVAIMGTGLWHMLHVNNASDFG
FRLKELSSHVESLVPFTPKEQEGGGSVSGRSVHLFWIGMPVLINGMLNTDEKKEKMSDTVWHEYDRSLGESKILRQMGGP
LILLDIQSFTWNCGPQCTLDGMHYDSAVYDAAVHVMLNALLIESHQTL*

DNA
ATGCTGGGAGCGATTCATTTCGGGGTATTAGCAGCTTGTTTCGTCCTATTCGTTCCCATGGCAATGGCTGGTTGGCATCT
GAGCAGGAACAAGATGCTCTTCTTTAGTGGCGCTTTGTTTATATCTCTCGCGGTTTGTGTTCACCTCACGCCTTATTTCC
CTTCCGTTTCCGACATCGTTGCCTCTGTTTCGTCTGTTGTTGTCTACGATCATCGTATCTCTTGTATTAACGAGGTGAAT
CAGATTGTCTGGGATGTTAAACCGGTCACGAATCCGGATTCTGTTCGTAGAAATAATGGCTCGACAAAGCTTGATTATTT
CGACAAGAACTGGGATTGGATTAAATCGAGGAAAGTTTTGAGTTGTGAGTTTCAGAAATTGGATAAGTTTGATGTTTCGG
ATTTGTTGAATGGATCTTGGGTTGTTGTTGCTGGTGATTCTCAGGCGAGATTCGTGGCTTTGTCGTTGTTGAATCTTGTT
TTGGGTTCGGATTCCAAGGCTATGGATTCGGTTAGAGGTGATCTGTTTAAGAGACATAGTGATTACAGCATTGTGGTTAA
AGAGATTGGGATGAAGCTAGATTTTGTGTGGGCTCCTTATGAGAAAGATTTGGATGATCTTGTGGTATCTTATACGAAGA
TGAAAAAGTATCCTGATGTTGCGATCATGGGAACTGGGTTATGGCATATGCTTCATGTGAACAATGCTTCGGATTTCGGT
TTTCGGTTGAAGGAATTGAGTAGTCATGTGGAGTCTCTAGTGCCCTTTACGCCAAAGGAGCAAGAAGGAGGCGGATCGGT
TTCCGGTAGATCTGTGCATCTGTTCTGGATTGGGATGCCGGTTTTGATCAACGGGATGTTGAATACGGATGAGAAGAAGG
AGAAGATGAGTGATACCGTGTGGCATGAGTATGATAGATCGCTCGGGGAGAGTAAGATCTTGCGCCAAATGGGCGGTCCT
CTTATCTTGCTTGATATCCAGTCCTTCACATGGAACTGTGGACCGCAATGTACACTTGACGGGATGCATTATGACTCTGC
GGTCTATGATGCCGCTGTCCATGTCATGCTCAATGCGTTGCTTATTGAATCTCATCAAACTTTATGA