Details for Lyrate rockcress Locus 16043970

Position : sca3 ( 5`- 4460196 .. 4460675 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16043970

Protein [Map View]
MTSSSPSPQASMILYWHENQYDDRNFQIHGRTLFFAMALFSVVIFFALLTLYIHRNCLSRNSLNLHAPSSDQHTRCAGGG
LDPATIRSLPVVLCRREAAEEEEEEKECCICLGGFEEGEKMKVLPPCSHCYHYECVDRWLNTESSCPLCRVNIRVDSSS*

DNA
ATGACGTCATCTTCACCGTCTCCACAAGCCTCGATGATTTTGTACTGGCATGAGAACCAATACGACGACCGCAACTTCCA
GATTCATGGCCGGACACTCTTCTTCGCCATGGCTCTATTTTCCGTTGTCATCTTCTTCGCACTACTCACTCTCTACATCC
ACCGGAACTGCCTCTCCCGGAATTCTCTTAATCTCCACGCACCCTCTTCTGATCAACACACACGTTGTGCTGGCGGAGGG
CTTGATCCGGCGACGATTCGGAGCTTGCCGGTGGTGCTTTGCAGGAGAGAAGCGGCGGAGGAGGAGGAGGAGGAGAAGGA
GTGTTGTATATGTCTAGGTGGTTTTGAAGAAGGAGAGAAGATGAAAGTGCTTCCTCCGTGTAGCCATTGTTACCACTACG
AATGTGTGGATAGGTGGCTTAACACCGAGTCGAGTTGTCCGCTCTGCCGAGTCAACATCCGAGTCGACTCGTCAAGCTAA