Details for Lyrate rockcress Locus 16043919

Position : sca3 ( 5`- 4514585 .. 4516819 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043919

Protein [Map View]
MDVIKTQQISARTIEKVIVHPLVLLSIVDHYNRVAKDTRKRVVGVLLGNSSRGTFDVTNSYAVPFEEDDKDTSIWFLDHN
YHESMFHMFKRINAKEHIVGWYRTGPKLRENDLDVHALFNGYVPNPVLVIIDVQPKELGIPTKAYYAVEEVKENATQKSQ
QVFVHVPTEIAAHEVEEIGVEHLLRDVKDTTISTLATEVTAKLTALKGLDARLREIRSYLDLVIEGKLPLNHEILYHLQD
VFNLLPNLNVNELVKAFAVKTNDMMLVIYLSALIRSVIALHNLINNKLLNKEHEKAEDSKPVAIPAISGS*

DNA
ATGGATGTTATAAAGACGCAACAAATATCGGCAAGGACGATAGAGAAAGTGATCGTTCACCCACTTGTCTTGCTTAGTAT
CGTCGACCATTACAATCGTGTAGCCAAGGATACACGCAAGCGCGTCGTCGGCGTTTTGCTCGGAAACAGCTCCCGTGGTA
CTTTCGACGTCACCAACAGCTACGCAGTGCCTTTTGAGGAGGATGACAAAGACACTAGCATCTGGTTTCTTGATCACAAC
TACCACGAGTCGATGTTTCACATGTTCAAGAGAATTAATGCTAAGGAGCATATTGTGGGTTGGTACAGAACAGGTCCTAA
ACTTCGAGAGAATGATTTGGATGTTCACGCTTTATTTAATGGCTACGTTCCAAATCCAGTGTTGGTCATTATTGATGTCC
AACCTAAAGAACTTGGAATCCCTACAAAGGCATACTATGCAGTTGAGGAGGTGAAGGAGAATGCTACCCAGAAAAGTCAG
CAGGTGTTTGTACACGTGCCTACAGAAATTGCGGCTCACGAAGTTGAGGAAATTGGTGTGGAACATTTGCTCAGAGATGT
AAAAGACACAACCATCAGTACCTTGGCAACTGAGGTCACGGCGAAACTTACTGCTCTGAAGGGATTGGATGCACGACTTC
GGGAGATCAGGAGTTACCTTGACCTTGTAATCGAAGGAAAACTCCCTTTAAACCATGAAATCTTGTACCATCTTCAGGAC
GTATTCAACTTGCTTCCTAACTTGAACGTCAACGAGTTGGTTAAGGCCTTTGCAGTGAAAACAAATGACATGATGCTCGT
AATCTACCTATCGGCGCTTATCCGAAGTGTAATCGCCCTCCACAATTTGATCAACAACAAGTTATTGAACAAGGAACATG
AAAAAGCAGAGGACTCAAAGCCTGTTGCCATACCTGCAATCAGTGGGAGTTAA