Details for Lyrate rockcress Locus 16043916

Position : sca3 ( 5`- 6212811 .. 6214226 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043916

Protein [Map View]
MESVKPLDVVASGKGKLRRTFAKVVNIKKLTGVVPEGDKVERVKKSQEKVKLDKDLVKNAANLSESFDKLEEEYEKRLAM
EALLAKLFATISSIKSGYAQLQYAQSPYDPNGIQKADNLVVAELKTLSELKQSFLKKQLDPNPDRTLVLAEIQELRSVLK
TYEITGKKLECQLKLKESEIIFLKEKYQESMSQNKLMEKRLNQSGQLCNPLDHNLHLSALNPTHLTTYLHHTVKSIRGFV
KLMIEQMKLAAWDIDMAADSIQPEVFYYKQDHKCFAFEHYVCKIMFEAFHLPYFSNESSKKKSREDREMFFERFTELRSM
KPKEYLASRPKSRLAKFCRGKYLQLIHPKMEHAFFGHLHLRNQVSAGEFPETSLCTAFLEMAKRVWLLHCLAFSFDPEAS
IFQVSRGCRFSEVYMKSVSEEAFFSRPEEEVSSSETEPGVAFTVVPGFRIGKALIQCEVFLSRSCQRRPIR*

DNA
ATGGAGTCTGTGAAACCATTGGATGTTGTTGCTTCAGGAAAAGGAAAACTCAGACGCACATTTGCTAAAGTTGTCAACAT
AAAAAAGCTAACCGGTGTTGTTCCAGAAGGCGACAAGGTTGAGAGAGTGAAGAAGAGCCAAGAAAAGGTGAAGTTGGATA
AAGATTTAGTGAAGAATGCTGCAAATCTGTCTGAGTCATTTGACAAGCTGGAGGAAGAGTATGAGAAAAGACTGGCAATG
GAAGCTCTACTTGCAAAGCTGTTTGCTACGATTTCTTCGATAAAATCTGGTTATGCGCAGTTGCAGTATGCTCAGTCTCC
TTATGATCCAAATGGGATTCAGAAAGCAGACAACTTGGTAGTAGCAGAGCTCAAGACATTATCAGAGCTGAAACAGAGTT
TCTTGAAGAAACAGCTTGATCCTAATCCTGATAGAACTCTTGTTCTTGCGGAGATTCAAGAGCTGAGAAGCGTCTTAAAG
ACTTATGAGATCACGGGGAAGAAGCTTGAGTGTCAGTTAAAGCTTAAAGAATCTGAGATCATATTTCTTAAAGAAAAGTA
TCAAGAATCCATGAGTCAGAACAAGTTGATGGAGAAGAGACTAAACCAAAGTGGCCAACTTTGCAATCCATTGGATCATA
ATCTTCATCTATCGGCGCTAAATCCAACCCATTTAACTACTTATCTGCACCACACTGTCAAATCAATCCGAGGATTCGTC
AAGTTAATGATTGAGCAGATGAAACTCGCAGCTTGGGACATCGATATGGCTGCTGATTCGATACAACCTGAAGTGTTCTA
TTACAAGCAAGACCACAAGTGTTTTGCTTTCGAGCATTACGTCTGCAAGATAATGTTTGAAGCGTTTCATCTACCTTACT
TCTCAAACGAATCATCGAAGAAGAAGAGCAGAGAAGACAGAGAGATGTTCTTTGAGAGATTCACAGAGCTTAGATCGATG
AAACCAAAAGAGTATTTAGCATCACGGCCTAAATCAAGATTGGCTAAGTTTTGCAGAGGGAAGTATTTGCAGCTCATACA
TCCAAAGATGGAGCACGCGTTCTTCGGACATTTGCATCTAAGAAACCAAGTCAGTGCAGGTGAGTTTCCGGAGACAAGCT
TGTGCACTGCGTTTCTCGAAATGGCGAAAAGGGTTTGGCTTTTACATTGCCTTGCTTTCTCCTTCGACCCTGAAGCTTCA
ATCTTTCAAGTATCTAGAGGATGCAGATTCTCCGAAGTGTACATGAAGAGTGTGTCAGAGGAAGCGTTTTTCTCTCGGCC
GGAGGAAGAAGTAAGCTCGTCGGAAACTGAGCCGGGAGTTGCGTTTACGGTGGTTCCTGGGTTTAGAATTGGGAAAGCGT
TGATACAATGTGAGGTTTTCCTCTCGCGTTCATGTCAACGCCGTCCGATCAGATAG